DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG7290

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001262093.1 Gene:CG7290 / 40211 FlyBaseID:FBgn0036949 Length:419 Species:Drosophila melanogaster


Alignment Length:208 Identity:49/208 - (23%)
Similarity:66/208 - (31%) Gaps:35/208 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TTVSAANFEC--PKPNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDC 78
            :|||.|...|  .|....|.....|..:..|.|.|..:..|.|||||   |.:.:.|.......|
  Fly   151 STVSVALNLCNLVKNGFYFGSPSDCSGWNFCQDNVLHSGSCEDGLVF---NVQASNCGYKMASSC 212

  Fly    79 EDRT---ELQEPKSSKYCPRKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWP 140
            ...|   .|....:...|.......|   ...||.:|.|..|:.....|..|.::|..|..||..
  Fly   213 AQVTNDPSLTGVSAPTTCSSSGATIA---ATACNQYYLCSAGNYQLMTCPSGYYYDTISKACVTR 274

  Fly   141 DTAKREGCNPEQRTSETGFVCPKDQPKTDDR--GQVVTHPKYPHPTDCQKFYVCLNGEDPRDLGC 203
            ..|:.:              |        ||  |...|.......|:|..:..|:||.......|
  Fly   275 MEARND--------------C--------DRCVGTTATFVNAYSATNCSDYLYCVNGVQKAVESC 317

  Fly   204 QLGEVYNDATEMC 216
            .....:|:....|
  Fly   318 PTNYYFNENLGSC 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 14/49 (29%)
CBM_14 95..143 CDD:366726 12/47 (26%)
CBM_14 180..225 CDD:366726 8/37 (22%)
CG7290NP_001262093.1 CBM_14 32..77 CDD:279884
CBM_14 91..142 CDD:279884
CBM_14 160..207 CDD:279884 15/49 (31%)
CBM_14 234..277 CDD:279884 12/45 (27%)
ChtBD2 <296..331 CDD:214696 8/35 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.