DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and obst-F

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster


Alignment Length:274 Identity:61/274 - (22%)
Similarity:85/274 - (31%) Gaps:95/274 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDCE--------------DRTEL-- 84
            :.|:.::.| ..|.....|..||.||. ||..  ||.|.|.:|.              |.:||  
  Fly    56 LDCNGYFSC-SRVPTLLYCDQGLQFDE-NRAI--CDLPENTNCRPVATGTVESANGLADNSELNW 116

  Fly    85 --QEPK----------------SSKYCP-----RKNGFFAHPDPAVCNIFYNCIEGDALETKCTV 126
              .:||                ..||.|     |..|.:..|.|..|.:::.|..|.....:|..
  Fly   117 WPHKPKPVFVAVDVTSGQPVNPMEKYDPEHIECRHYGAYFLPHPRNCGLYFICAYGHLHRHQCGR 181

  Fly   127 GLHFDEYSGTCVWPDTAKREGCNPEQRTSE--TGFVCPKDQPKTDDRGQV--------------- 174
            |..::.....|...|.|.   |..|.:.||  |........|..:..|.|               
  Fly   182 GTAWNFEKSECQLSDQAI---CYGESQISEPHTDVETTMKVPTANSEGAVTVCYIVGSSEYTTLQ 243

  Fly   175 -------------VTHPKYP------------------HPTDCQKFYVCLNGEDPRDLGCQLGEV 208
                         ||.|..|                  ||.||.|:|:|:.|. |....|..|..
  Fly   244 QFLTSPEITELPPVTPPSPPRAEANALTCPSTKQSYMSHPEDCSKYYICIGGM-PVLTSCPKGLF 307

  Fly   209 YNDATEMCDAPENV 222
            ::..:..|:..:||
  Fly   308 WDQKSGFCEMEKNV 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 14/40 (35%)
CBM_14 95..143 CDD:366726 11/47 (23%)
CBM_14 180..225 CDD:366726 15/61 (25%)
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 14/41 (34%)
CBM_14 156..198 CDD:279884 9/41 (22%)
CBM_14 272..321 CDD:279884 12/49 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443992
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.