DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and obst-J

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_649179.2 Gene:obst-J / 40202 FlyBaseID:FBgn0036940 Length:353 Species:Drosophila melanogaster


Alignment Length:218 Identity:49/218 - (22%)
Similarity:81/218 - (37%) Gaps:47/218 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LCVATTVSAANFECPKPNGQFADEVQCDKFYVCDDG----VAKAKLCPDGLVFDPLNRKFNKCDQ 72
            :||....:..:..|...|.....:..|.::..|.:|    |||   |..|..|||..|   .| .
  Fly    76 ICVPGACTDESVFCGLTNSVERVQSDCTRYRQCLEGGSFAVAK---CSVGNYFDPARR---AC-L 133

  Fly    73 PFNVDCEDRTELQEPKSSKYCPRKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTC 137
            |..:....:.....|.::...          :|:.|..::.|..|.|...:|..|.:|||...:|
  Fly   134 PVAISAAHQCSCVLPDNATLA----------NPSDCETYFRCHSGQAELVQCPSGDYFDERVSSC 188

  Fly   138 VWPDTAKREGCNPEQRTSETGFVC---PKDQPKTDDRGQVV-----THPKY-PHPTDCQKFYVCL 193
            | ||              .|| :|   |...|...::...:     |..:. ||..|||::|:|.
  Fly   189 V-PD--------------HTG-ICLEKPTMPPTLTEQALAMDECIRTGSRLAPHSRDCQRYYICA 237

  Fly   194 NGEDPRDLGCQLGEVYNDATEMC 216
            . :...::.|..|:.::.....|
  Fly   238 K-KRVLEMRCPRGQYFDVVRRYC 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 15/53 (28%)
CBM_14 95..143 CDD:366726 14/47 (30%)
CBM_14 180..225 CDD:366726 10/38 (26%)
obst-JNP_649179.2 ChtBD2 <40..79 CDD:214696 1/2 (50%)
CBM_14 145..192 CDD:279884 15/71 (21%)
CBM_14 216..259 CDD:279884 10/43 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.