DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG10140

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster


Alignment Length:223 Identity:56/223 - (25%)
Similarity:81/223 - (36%) Gaps:54/223 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TVSAANFECPKPNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDCEDR 81
            |..|.||      ..|:.:..|.::.:|..|....:.|.|||.:   |...::||.|.||||   
  Fly   110 TCEAFNF------STFSYQRTCTRYVLCYYGKPVLRQCQDGLQY---NSATDRCDFPQNVDC--- 162

  Fly    82 TELQEPKSSKYCPRKNGFFAH--PDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAK 144
               .|.:.|.|   .|.:...  |....|..::.|..|...|..||.||||......|   |...
  Fly   163 ---VESECSIY---SNAYHLRYVPSKVSCQKYFICGNGIPREQTCTAGLHFSTKCDCC---DIPS 218

  Fly   145 REGCN---PEQRTSE--------TGFVCPKDQPKTDDRGQVVTHPK----YPHPTDCQKFYVCLN 194
            :..|.   .|::..:        |..:||               |.    |.|.:....:|.|::
  Fly   219 KSDCQIPAVERKVQQLSRLSPVTTVGICP---------------PSGVHFYVHESRRDAYYYCVD 268

  Fly   195 GEDPRDLGCQLGEVYNDATEMCDAPENV 222
            |.. ..|.|..|..|:...:.|..|:||
  Fly   269 GHG-LVLDCSAGLWYDPTVQECREPQNV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 13/49 (27%)
CBM_14 95..143 CDD:366726 14/49 (29%)
CBM_14 180..225 CDD:366726 13/43 (30%)
CG10140NP_648648.2 CBM_14 63..106 CDD:279884
CBM_14 111..161 CDD:279884 16/58 (28%)
CBM_14 178..222 CDD:279884 13/46 (28%)
CBM_14 246..295 CDD:279884 14/64 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444146
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.