DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG10725

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster


Alignment Length:264 Identity:66/264 - (25%)
Similarity:93/264 - (35%) Gaps:83/264 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLFLCAIAVTLCVATTVSAANFECP------------------------KPNG--QFADEVQCDK 40
            |.|||...:         |...|||                        |..|  .|..:..|.|
  Fly    44 KYFLCMNEI---------AVPRECPTDYYFDARDQECVPLMEVECIGSCKNRGLSSFCYDRTCTK 99

  Fly    41 FYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDCEDRTELQEPKSSKYCPRKNGFFAHPDP 105
            :.:|.||....:.|.|||.::.|.   ::||.|..|||.|          ..|.|.|    :||.
  Fly   100 YVLCFDGTPVIRQCSDGLQYNALT---DRCDYPQYVDCVD----------NLCSRNN----NPDD 147

  Fly   106 AV-------CNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKREGCNPE--QRTSETGFVC 161
            .|       |:.:|.|::|......||.||.::..:.:|.:|   .:..|..|  ||.     :.
  Fly   148 IVFIPSKARCDKYYICMDGLPQVQNCTSGLQYNPSTQSCDFP---SKVNCTVESLQRN-----IL 204

  Fly   162 P--KDQPKTDD------RGQVVTHPKYPHPTDCQKFYVCLNGEDPRDLGCQLGEVYNDATEMCDA 218
            |  :..|:..|      ....:.|.|..     ..:|.||||... .|.|..|.|::...|.|..
  Fly   205 PFARAPPRLADIECPSEGAHFIAHQKRQ-----DAYYYCLNGRGV-TLDCTPGLVFDAKREECRE 263

  Fly   219 PENV 222
            |..|
  Fly   264 PHLV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 16/51 (31%)
CBM_14 95..143 CDD:366726 15/54 (28%)
CBM_14 180..225 CDD:366726 13/43 (30%)
CG10725NP_648647.1 CBM_14 35..73 CDD:279884 8/37 (22%)
CBM_14 83..134 CDD:279884 17/53 (32%)
CBM_14 150..192 CDD:279884 10/44 (23%)
ChtBD2 216..264 CDD:214696 13/53 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.