DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG43896

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001261732.1 Gene:CG43896 / 39360 FlyBaseID:FBgn0264488 Length:2113 Species:Drosophila melanogaster


Alignment Length:241 Identity:65/241 - (26%)
Similarity:97/241 - (40%) Gaps:43/241 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VATTVSAANFEC------PKPNGQFAD-EVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKC- 70
            :|..:..||..|      .|.||.|.: |..|..:|||.:|.|..:.||.|..|   |.....| 
  Fly   137 LAACIPDANSTCWQNLCINKTNGVFVENEANCGSYYVCSNGEATLQTCPQGSFF---NTSVAACT 198

  Fly    71 -DQPFNVDCEDRTELQEPKSSKYCPRKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYS 134
             ||. |..|          ...||..::...|..|.:.|::||.|....|...:|..|.:|:..:
  Fly   199 VDQG-NSQC----------WVNYCIGQDDGSAVADKSNCSLFYVCSNNTATAQECPEGSYFESNN 252

  Fly   135 GTCVWPDTAKREG-CNPEQRTSETGFVCPK---DQPKTDDRGQVVTHPKYPHPTDCQKFYVCLNG 195
            ..|| |.|...|. |  :..|:.|...|.:   :.|.:.|.|.:......|...:|:|:::|::|
  Fly   253 WGCV-PGTCTTESPC--DDSTTTTTESCAEETTEPPASCDCGDIKNADFIPDEENCRKYFICIDG 314

  Fly   196 ----EDPRDLGCQLGEVYNDATEMCDAPEN----VPGCEDWYKDVD 233
                .|     |..|.|:|....:|:...:    |..|.|....||
  Fly   315 VLVAAD-----CGKGNVFNANLSVCEVDADNTCCVADCTDGEAKVD 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 20/52 (38%)
CBM_14 95..143 CDD:366726 13/47 (28%)
CBM_14 180..225 CDD:366726 12/52 (23%)
CG43896NP_001261732.1 CBM_14 96..147 CDD:279884 3/9 (33%)
CBM_14 153..206 CDD:279884 20/56 (36%)
CBM_14 211..257 CDD:279884 13/46 (28%)
CBM_14 298..343 CDD:279884 11/49 (22%)
CBM_14 354..395 CDD:279884 2/2 (100%)
CBM_14 427..468 CDD:279884
ChtBD2 488..535 CDD:214696
CBM_14 544..593 CDD:279884
CBM_14 <1320..1361 CDD:279884
ChtBD2 1627..1675 CDD:214696
CBM_14 1684..1733 CDD:279884
ChtBD2 1752..1797 CDD:214696
CBM_14 1820..1868 CDD:279884
CBM_14 1896..1939 CDD:279884
ChtBD2 2046..2091 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443986
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.