DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG11570

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001356902.1 Gene:CG11570 / 39357 FlyBaseID:FBgn0036230 Length:262 Species:Drosophila melanogaster


Alignment Length:284 Identity:60/284 - (21%)
Similarity:83/284 - (29%) Gaps:100/284 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LCAIAVTLC-----VATTVSAANFECPK------------PNGQFADEVQCDKFYVCDDGVAKAK 52
            |..||:..|     :.:.|:..:.:||.            ||       .|.|:|||..|.|..:
  Fly    13 LAFIAIVDCQENNNLVSIVTDHSIQCPPFDDPNHNVMLPYPN-------DCSKYYVCQKGRAYEQ 70

  Fly    53 LCPDGLVFDPLNRKFNKCDQPFNVDCEDRTELQEPKSSKYCPRKNG-----FFAHPDPAVCNIFY 112
            .||..|.:..:.   .:||.....:|           :.|.|..|.     |.|:|..  |..||
  Fly    71 QCPLNLFWSQMT---YRCDYKEYSNC-----------NTYIPSPNHDVEVIFSAYPGD--CRRFY 119

  Fly   113 NCIEGDALET---KCTVGLHFDEYSGTCVWPDTAKREGCNPEQRT-----------------SET 157
                    ||   :|...|.:......||.|...   .|.....|                 :..
  Fly   120 --------ETRILRCEQNLQWSSVYQRCVVPQYG---DCQNSPVTVPPVVPFTPLPTYPPVPTVP 173

  Fly   158 GFVCPKDQPKTDDRGQVVT--------------------HPKYPHPTDCQKFYVCLNGEDPRDLG 202
            ..|.|.|...|......:|                    :...|:|..|:||..|  |.....|.
  Fly   174 ATVIPYDPMPTAGTPPPITPMESLPLPIDVQSLCNNSPPNAYIPYPGSCKKFIHC--GPTATILS 236

  Fly   203 CQLGEVYNDATEMCDAPENVPGCE 226
            |.....:|.|...|....|  ||:
  Fly   237 CAGSSNWNPAQHACTTYSN--GCQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 14/61 (23%)
CBM_14 95..143 CDD:366726 14/55 (25%)
CBM_14 180..225 CDD:366726 13/44 (30%)
CG11570NP_001356902.1 CBM_14 51..93 CDD:307643 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.