DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and obst-G

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_648529.1 Gene:obst-G / 39355 FlyBaseID:FBgn0036228 Length:279 Species:Drosophila melanogaster


Alignment Length:276 Identity:74/276 - (26%)
Similarity:101/276 - (36%) Gaps:69/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLF--LCAIAV----TLCVATTVSAANFE-CPKPNG----QFADEVQCDKFYVCDDGVAKAKLC 54
            ||||  ||.:.|    ||.|.....|.... |...||    .|.   .|..:|||.||.|....|
  Fly     1 MKLFGLLCVMLVLQESTLAVVQNGFAFKTSLCEGKNGGLLPMFG---SCKGYYVCADGNAVTGTC 62

  Fly    55 PDGLVFDPLNRKFNKCDQPFNVDC------------------EDRTE-------------LQEPK 88
            ....:|:||..   .||.|.||||                  ||..|             .::|:
  Fly    63 EKNTLFNPLTL---HCDDPDNVDCIFDGKDNIVDDTSSSESDEDDDEEMAKTDPPVTVKATKKPR 124

  Fly    89 SS---KYCP-RKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKREGCN 149
            .:   |.|. :|:|.....:.: |..:|.|.........|....||......|:....||..|..
  Fly   125 PTTLDKMCAGKKDGVMLTKNGS-CQEYYVCKAKKPHLRSCPDKQHFSPTRRICMKASEAKCSGGT 188

  Fly   150 PEQRTSE----TGFVCPKDQPKTDDRGQVVTHPKYPHPTDCQKFYVCLNGEDPRDLGCQLGEVYN 210
            .|.:.|:    ||.||      :|::...:.    .|.:||.||.:|.|... ..:.|..|..:|
  Fly   189 RENKESDGPATTGGVC------SDEKENSLV----AHRSDCGKFMLCSNMMF-LVMDCPTGLHFN 242

  Fly   211 DATEMCDAPENVPGCE 226
            .||..||.|: :..|:
  Fly   243 IATSRCDYPK-IAKCQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 18/53 (34%)
CBM_14 95..143 CDD:366726 9/47 (19%)
CBM_14 180..225 CDD:366726 15/44 (34%)
obst-GNP_648529.1 CBM_14 32..83 CDD:279884 20/56 (36%)
CBM_14 132..184 CDD:279884 11/52 (21%)
CBM_14 204..256 CDD:279884 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444148
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.