| Sequence 1: | NP_001245778.1 | Gene: | obst-A / 33022 | FlyBaseID: | FBgn0031097 | Length: | 237 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_648528.1 | Gene: | CG17826 / 39354 | FlyBaseID: | FBgn0036227 | Length: | 751 | Species: | Drosophila melanogaster |
| Alignment Length: | 257 | Identity: | 59/257 - (22%) |
|---|---|---|---|
| Similarity: | 85/257 - (33%) | Gaps: | 78/257 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 25 CPKPNGQF-------------ADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKC---DQP 73
Fly 74 FNVDCE--------DRTELQEPKSSKYCPRK--NGFFAHPDPAVCNI------------------ 110
Fly 111 --------FYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKREGCNPEQRTSETGFVCPKDQPK 167
Fly 168 TDDRG--QVVTHPKYPHPTDCQKFYVCLNGEDPRDLGCQLGEVYNDATEMCDAPENVPGCED 227 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| obst-A | NP_001245778.1 | CBM_14 | 27..77 | CDD:366726 | 15/65 (23%) |
| CBM_14 | 95..143 | CDD:366726 | 10/75 (13%) | ||
| CBM_14 | 180..225 | CDD:366726 | 17/44 (39%) | ||
| CG17826 | NP_648528.1 | CBM_14 | 36..74 | CDD:279884 | |
| ChtBD2 | <89..124 | CDD:214696 | |||
| CBM_14 | 145..184 | CDD:279884 | |||
| CBM_14 | 251..290 | CDD:279884 | |||
| CBM_14 | 357..396 | CDD:279884 | |||
| CBM_14 | 463..502 | CDD:279884 | 11/41 (27%) | ||
| CBM_14 | 563..610 | CDD:279884 | 8/62 (13%) | ||
| CBM_14 | 621..670 | CDD:279884 | 16/49 (33%) | ||
| CBM_14 | 697..749 | CDD:279884 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45443990 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR23301 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.940 | |||||