DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG5883

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster


Alignment Length:250 Identity:53/250 - (21%)
Similarity:90/250 - (36%) Gaps:63/250 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AIAVTLCVATTVSAANFECPKPNGQFADEVQCDKFYVCD-DGVAKAKLCPDGLVFDPLNRKFNKC 70
            |.|.|.|..:.:...:     ..|...|.:.|..:|.|| |.:.....|..|:.||.:::   .|
  Fly    83 ASADTYCDTSKICKGS-----GTGYIGDTINCANWYYCDADALLGKGTCNLGMYFDQVSK---SC 139

  Fly    71 DQPFNVDCEDRTELQE--PKSSKYCPRKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEY 133
            ....:..|..:.|:.:  |..:.:          .|.|.|:.:|.|.....:|..|..||:::..
  Fly   140 VYSEDTVCAAKYEICDVAPVGTPF----------RDDANCHKYYTCSSKSLVENTCENGLYYNVA 194

  Fly   134 SGTCVWPDTAKREGCNPEQRTSETGFVCPKDQPKTDD----RGQVVTHPKYPHPTDCQKFYVCLN 194
            :||||    .|::            .:| ::.|..|:    :...|.:........|:.:|.|  
  Fly   195 TGTCV----RKKD------------VIC-ENHPLPDEVCGNKKLAVRNKFVSDMATCRGYYYC-- 240

  Fly   195 GEDPRDLG------------CQLGEVYNDATEMCDAPENVPGCEDWYKDVDDKKD 237
                ||||            |.....:|...:.| .|.....|:  |...|.:||
  Fly   241 ----RDLGSGIPDTDPIYQQCDENNFFNQERQAC-MPRESQKCD--YDRCDGRKD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 12/50 (24%)
CBM_14 95..143 CDD:366726 13/47 (28%)
CBM_14 180..225 CDD:366726 11/56 (20%)
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 12/58 (21%)
CBM_14 154..204 CDD:279884 15/75 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444139
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.