DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG5897

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001356901.1 Gene:CG5897 / 39346 FlyBaseID:FBgn0036220 Length:343 Species:Drosophila melanogaster


Alignment Length:258 Identity:61/258 - (23%)
Similarity:86/258 - (33%) Gaps:92/258 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LCAIAVTLCVATTVSAANFE--CP--KPNGQFADEVQCDKFYVCDDG-VAKAKLCPDGLVF---- 60
            ||.|   |.:...:...:.|  |.  ...|...|...|..:..|.|. :...:.|.:||::    
  Fly    10 LCVI---LAIVAEIRGFSMEDKCKLWAGTGYIGDPSDCQAWGYCQDNKLIDRRSCTEGLLYSFRD 71

  Fly    61 ----------------------DPLN--------RKFNKC---DQPFNVDC--------EDRTEL 84
                                  :|.|        |:|.||   |.|...||        :.:|.|
  Fly    72 GTCKRASDTICHSQLSEICASLEPWNYVANPADCRRFVKCADLDDPTWGDCGVGQVFSNKKQTCL 136

  Fly    85 QEPKSSKYCPR-------KNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDT 142
            :|...   ||:       |:|.|. .||..|.|:|.|..|......|:||.:|:..:|.|     
  Fly   137 EEVAG---CPQDNICSHMKDGSFV-GDPKSCQIYYKCHNGFGTMLNCSVGRYFNRKTGNC----- 192

  Fly   143 AKREGCNPEQRTSETGFVCPKDQPKTDDRGQVVTHPKYPHPTDCQKFYVCLNGEDPRDLGCQL 205
                       .|.....|.|     ||...::|.|...| ..|.|:|     :..|| |.||
  Fly   193 -----------QSWMPHYCSK-----DDEDNILTPPSTDH-NICSKYY-----QRDRD-GVQL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 16/87 (18%)
CBM_14 95..143 CDD:366726 16/54 (30%)
CBM_14 180..225 CDD:366726 9/26 (35%)
CG5897NP_001356901.1 ChtBD2 146..192 CDD:214696 15/46 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444161
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.