DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and Muc68D

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster


Alignment Length:205 Identity:67/205 - (32%)
Similarity:97/205 - (47%) Gaps:33/205 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PNGQFADEVQ-CDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDC--EDRTE--LQEP 87
            |||.|..:.| |:|:|||.:|.|.|..||..|.|| :.||.  |:.|..|||  ::..|  .::|
  Fly  1318 PNGIFLRDFQSCNKYYVCLNGKAIAGHCPRNLHFD-IKRKV--CNFPSLVDCPLDEAPENVTKKP 1379

  Fly    88 KSSKYCP----RKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKREGC 148
            ..::..|    .:||.:.. ||..|:.||.|..|.|:..:|..|||||..|..|.:|...:   |
  Fly  1380 SDTESTPDCKSLRNGAYVR-DPKSCSRFYVCANGRAIPRQCPQGLHFDIKSNFCNYPILVQ---C 1440

  Fly   149 NPEQRTSET-GFVCPKDQP-----KTDDR-GQVVTHPKYPHPTDCQKFYVCLNGEDPRDLGCQLG 206
            :.|:..::. |.:..:..|     |.|.| |.|..|.||         ||||.|:..... |..|
  Fly  1441 SLEESQADAHGALLAEGVPDCTKVKEDTRFGDVKQHNKY---------YVCLKGKAVLHY-CSPG 1495

  Fly   207 EVYNDATEMC 216
            ..::..::.|
  Fly  1496 NWFDLRSQKC 1505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 22/49 (45%)
CBM_14 95..143 CDD:366726 19/47 (40%)
CBM_14 180..225 CDD:366726 9/37 (24%)
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 23/50 (46%)
CBM_14 1388..1440 CDD:279884 19/55 (35%)
ChtBD2 1459..1505 CDD:214696 16/55 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.