Sequence 1: | NP_001245778.1 | Gene: | obst-A / 33022 | FlyBaseID: | FBgn0031097 | Length: | 237 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001034018.1 | Gene: | CG33985 / 3885639 | FlyBaseID: | FBgn0053985 | Length: | 277 | Species: | Drosophila melanogaster |
Alignment Length: | 254 | Identity: | 50/254 - (19%) |
---|---|---|---|
Similarity: | 81/254 - (31%) | Gaps: | 89/254 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 AIAVTLCVATTVSAANF-ECPKPNG-QFADEVQ-CDKFYVCDDGVAKAKLCPDGLVFDPLNRKFN 68
Fly 69 KCDQPFNVDCEDRTELQEPKS-------------------------------------------- 89
Fly 90 ----------SKYCPR---KNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPD 141
Fly 142 TAKREGC-----NPEQRTSETGFVCPKDQPKTDDRGQVVTHPKYPHPTDCQKFYVCLNG 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
obst-A | NP_001245778.1 | CBM_14 | 27..77 | CDD:366726 | 9/51 (18%) |
CBM_14 | 95..143 | CDD:366726 | 14/50 (28%) | ||
CBM_14 | 180..225 | CDD:366726 | 8/16 (50%) | ||
CG33985 | NP_001034018.1 | CBM_14 | 28..74 | CDD:279884 | 10/48 (21%) |
CBM_14 | 160..202 | CDD:279884 | 14/41 (34%) | ||
ChtBD2 | 215..259 | CDD:214696 | 10/35 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |