DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG33986

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster


Alignment Length:227 Identity:54/227 - (23%)
Similarity:87/227 - (38%) Gaps:55/227 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GQFADEVQ-CDKFYVC-DDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDCEDRTE-LQEP---- 87
            |:|.:..: |..||:| ::|.|....||..::|   |.:...||...||.|.:.|: ::.|    
  Fly    47 GEFVEHAEDCHMFYLCVENGDAVLASCPPTMLF---NSESRLCDSATNVKCRNETDPIETPPFDG 108

  Fly    88 ------------KSSKYCPRKNGFFAHPDPAV-------CNIFYNCIEGDALETKCTVGLHFDEY 133
                        .::.||..........|..|       |..:|.|..|.|:..:|:..||::..
  Fly   109 GNGDGDPNNMVTDAATYCSTLVEQQQSSDRIVYVGSSSSCRKYYICYYGQAILQECSSQLHWNAM 173

  Fly   134 SGTCVWPDTAK-REGCNPEQRTS-ETGFV------------CPKDQPKTDDRGQVVTHPKYPHPT 184
            :|.|..|:.|: ..|...:..|: .:||.            ||.       .||.:    |||..
  Fly   174 TGKCDIPERAQCTVGGQEDMPTNGNSGFPSGGTAISSDLIHCPA-------YGQHL----YPHMQ 227

  Fly   185 DCQKFYVCLNGEDPRDLGCQLGEVYNDATEMC 216
            .|:.|..|:.|..... .|.....::.||:.|
  Fly   228 RCEFFIYCVKGHASLQ-QCPFYYFFDIATKSC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 15/48 (31%)
CBM_14 95..143 CDD:366726 13/54 (24%)
CBM_14 180..225 CDD:366726 11/37 (30%)
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 14/47 (30%)
CBM_14 141..185 CDD:279884 12/43 (28%)
ChtBD2 213..261 CDD:214696 15/58 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.