DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG4835

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster


Alignment Length:265 Identity:64/265 - (24%)
Similarity:85/265 - (32%) Gaps:88/265 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDC----------EDRT---------- 82
            |..|.|||......||||..|.:|   .|..:|:.|..|:|          .|.|          
  Fly    66 CSLFLVCDCLYPTVKLCPANLWWD---NKTQQCNYPQAVECIYYSIETPEPTDGTTRFTPEPTSS 127

  Fly    83 ------ELQEPKSS-----------------------------------------KYCPRKNGFF 100
                  |..||.||                                         .||..|....
  Fly   128 TQKITPEPTEPPSSTAKITTESTTGTSTEITSSTPSSYLPTSSWDPPPAPPGISDDYCRNKEDGS 192

  Fly   101 AHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKREGC--------NPEQRTSET 157
            .|..|..|..:.||..|..:...|.....|::|.|.|..||.|..|..        .|...|:|.
  Fly   193 VHYYPYDCQAYINCTYGWPVLNYCIEDKVFNKYLGICDTPDMADCEELPLPTTTTEMPPTSTTEE 257

  Fly   158 GFVC-PKDQPKTDDRGQVVTHPK----YPHPTDCQKFYVCLNGEDPRDLGCQLGEVYNDATEMCD 217
            ..|| |..:...:|    ...||    |.:|.:|..:..|.||....|. ||..:::|:...:||
  Fly   258 DVVCGPTPEGIEED----YCVPKGNGFYEYPYNCSGYLACKNGCTDLDY-CQPDKLFNNWLHICD 317

  Fly   218 APENV 222
            .|::|
  Fly   318 TPDSV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 14/38 (37%)
CBM_14 95..143 CDD:366726 14/47 (30%)
CBM_14 180..225 CDD:366726 14/43 (33%)
CG4835NP_647965.3 CBM_14 51..103 CDD:279884 15/39 (38%)
CBM_14 185..237 CDD:279884 16/51 (31%)
CBM_14 273..322 CDD:279884 15/49 (31%)
CBM_14 393..444 CDD:279884
CBM_14 485..539 CDD:279884
CBM_14 585..638 CDD:279884
CBM_14 661..714 CDD:279884
CBM_14 744..796 CDD:279884
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443998
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.