DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG32302

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:155 Identity:42/155 - (27%)
Similarity:64/155 - (41%) Gaps:37/155 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CDQPFNVDCED--------RTELQEPKSSKYCPRKNGFFAHPDPAVCNIFYNCIEGDALETK--C 124
            |...:|..|.|        :::.|.||...:..::.|.|  |||..|..::.|.: .:::|.  |
  Fly    61 CQSEYNFYCSDEGTFGCTFQSQCQVPKRGPFSCQQAGLF--PDPYDCRRYHECSD-QSVDTPRIC 122

  Fly   125 TVGLHFDEYSGTCVWPDTAKREGCNPEQRTSETGFVCPKDQPKTDDRGQVVTHPKYPHPTDCQKF 189
            :.|..:...:||||.|  .:.|.|..||      |.|.:.       |||     .....|.:.|
  Fly   123 SNGAGYSTLTGTCVLP--RESEQCIQEQ------FTCSRS-------GQV-----GGWAPDNRYF 167

  Fly   190 YVCLNGED----PRDLGCQLGEVYN 210
            |||:|...    |..:.|..|.|:|
  Fly   168 YVCVNDTANSLYPLMMKCHEGFVFN 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 2/6 (33%)
CBM_14 95..143 CDD:366726 15/49 (31%)
CBM_14 180..225 CDD:366726 11/35 (31%)
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 16/54 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444144
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.