DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG13806

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_647708.1 Gene:CG13806 / 38292 FlyBaseID:FBgn0035325 Length:297 Species:Drosophila melanogaster


Alignment Length:224 Identity:59/224 - (26%)
Similarity:80/224 - (35%) Gaps:61/224 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NFECPKPNGQFADEVQCDKFYVC----DDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDCEDRT 82
            ||:|.. .|.|.|...|.|:::|    ...||.|..|.:...||...   .:|    .:...|..
  Fly   101 NFQCTS-QGIFPDPYDCQKYHMCYFVGATLVAAAVDCGNDKAFDATT---GQC----TLTLTDSV 157

  Fly    83 ELQEPKSSKYCPRKNGFFAHP-DPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKRE 146
            .||.   ..|||......|.| :|   ||||.|        |.||..:.::  ...::|...:  
  Fly   158 CLQR---QYYCPNAGHVAAWPTNP---NIFYVC--------KSTVNQNLND--TIVIYPSLHR-- 204

  Fly   147 GCNPEQRTSET--GFVCPKDQ----PKTDDRGQVVTHPK------YPHP----------TDCQKF 189
             ||    ..||  .:||....    |.|||...::..|.      .|:.          .||:|:
  Fly   205 -CN----DGETFVDYVCRSGSNVLPPSTDDPSVIIEDPNDDDFSVLPNTCQHVGLMADGNDCRKY 264

  Fly   190 YVC--LNGEDPRDLGCQLGEVYNDATEMC 216
            |.|  ||| ..|.:.|..|..|......|
  Fly   265 YYCSALNG-TLRHMDCPNGTYYRPELSSC 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 13/53 (25%)
CBM_14 95..143 CDD:366726 12/48 (25%)
CBM_14 180..225 CDD:366726 14/49 (29%)
CG13806NP_647708.1 CBM_14 105..158 CDD:279884 14/60 (23%)
ChtBD2 247..293 CDD:214696 13/47 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.