DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and obst-B

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster


Alignment Length:214 Identity:99/214 - (46%)
Similarity:130/214 - (60%) Gaps:9/214 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ECPKPNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDCEDRTELQEPK 88
            |||:|||.:.|..||||:|.|.|||...:||.||:||:..:....|||.|:|:||..|::||.|:
  Fly    85 ECPEPNGFYPDSKQCDKYYACLDGVPTERLCADGMVFNDYSPIEEKCDLPYNIDCMKRSKLQTPQ 149

  Fly    89 SSKYCPRKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKREGCNPEQR 153
            .|.:||||||:|.|..|.:|:.||.|::|......|..||.|:..:|.|.|||.....||..|  
  Fly   150 PSLHCPRKNGYFGHEKPGICDKFYFCVDGQFNMITCPAGLVFNPKTGICGWPDQVGVTGCKSE-- 212

  Fly   154 TSETGFVCPKDQPKTDDRGQVVTHPKYPHPTDCQKFYVCLNGEDPRDLGCQLGEVYNDATEMCDA 218
             ....|.|||     .:....||||:|..|.|||.||||:||:.||..||:||:|:::..|.||.
  Fly   213 -DVFDFECPK-----VNESIAVTHPRYADPNDCQFFYVCVNGDLPRRNGCKLGQVFDEEKETCDW 271

  Fly   219 PENVPGCEDWYKD-VDDKK 236
            ...||.|.||||| :.||:
  Fly   272 ARKVPDCADWYKDRLTDKE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 24/49 (49%)
CBM_14 95..143 CDD:366726 21/47 (45%)
CBM_14 180..225 CDD:366726 23/44 (52%)
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 24/49 (49%)
CBM_14 156..204 CDD:279884 21/47 (45%)
CBM_14 233..278 CDD:279884 23/44 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444143
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D106606at50557
OrthoFinder 1 1.000 - - FOG0004529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.