DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and obst-E

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster


Alignment Length:227 Identity:85/227 - (37%)
Similarity:117/227 - (51%) Gaps:16/227 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IAVTLCVAT--TVSAANFECPKPNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKC 70
            |:..||||.  :::..:.|||.|||:||...|||.:..|.||....|||||||:|....:...:|
  Fly     6 ISALLCVAMFGSMALGSPECPTPNGRFASGDQCDSYTECQDGTPVEKLCPDGLLFHQRTKATGEC 70

  Fly    71 D-QPFNVDCEDRTELQEPKSSKYCPRKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYS 134
            . .|::. |::|..||....::.|||:.||:.:.|...|.::.||..|.|..|||..||.|:|.:
  Fly    71 TYAPYST-CKERARLQPANGTEECPRQFGFYPNGDATKCGVYRNCAHGVASLTKCPEGLAFNEET 134

  Fly   135 GTCVWPDTAKREGCNPEQRTSETGFVCPKDQPKTDDRGQVV-THPK-----YPHPTDCQKFYVCL 193
            ..|.|||..  |.||.|   :..||.||......|.....| ..|:     |.||..|:|::||:
  Fly   135 YQCDWPDLV--ESCNAE---AYLGFNCPAADSADDSAAAAVDVSPEGELRYYRHPQTCKKYFVCV 194

  Fly   194 NGEDPRDLGCQLGEVYNDATEMCDAPENVPGC 225
            ||. ||...|.....:|..|::||....||.|
  Fly   195 NGH-PRLYNCGKYLAFNSQTKLCDFYNKVPEC 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 21/50 (42%)
CBM_14 95..143 CDD:366726 20/47 (43%)
CBM_14 180..225 CDD:366726 18/44 (41%)
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 22/41 (54%)
CBM_14 95..146 CDD:307643 21/52 (40%)
CBM_14 180..225 CDD:307643 18/45 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1157817at2759
OrthoFinder 1 1.000 - - FOG0004529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.