DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and Cht10

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster


Alignment Length:245 Identity:61/245 - (24%)
Similarity:88/245 - (35%) Gaps:55/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ECPKPNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDC-EDRTELQEP 87
            ||.:  |.:.....|.|:|:|.:.......|...|.:|.:.:   .||.|.||.| ..:..|:..
  Fly   799 ECTE--GDYYPHRNCRKYYICVNKALVPSECGGDLHWDGIKK---LCDWPENVQCVTSKKYLKII 858

  Fly    88 KSSKY-----CPRKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKREG 147
            |||..     |   .|....|.|..|:.:..|:......:.|..|||::|..|.|.||..||   
  Fly   859 KSSSANEEDPC---KGEKRVPYPGNCSKYLFCLWNRLQASDCPPGLHYNERIGNCDWPAAAK--- 917

  Fly   148 CNPE-QRTSETGFVCPKDQPKTDDRGQVVTHPKY------PHPTDCQKFYVC-----------LN 194
            |||: ..:||...:....:|.|.........|.|      |.|.|.....:|           :.
  Fly   918 CNPKGSESSEEAELNAMPKPPTPQTPSSHLRPTYPTEKPVPKPRDSHYKVICYFTNWAWYRKGIG 982

  Fly   195 GEDPRDLGCQLGEVYNDATEMC----------DAPENVPGCEDWYKDVDD 234
            ...|.|:.          ||:|          |..|.|....|.:.||::
  Fly   983 RFTPDDIN----------TELCTHVIYGFAVLDYSELVLRTHDSWADVEN 1022

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 12/49 (24%)
CBM_14 95..143 CDD:366726 14/47 (30%)
CBM_14 180..225 CDD:366726 13/71 (18%)
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884 13/51 (25%)
CBM_14 875..918 CDD:279884 15/45 (33%)
Glyco_18 966..1310 CDD:214753 12/67 (18%)
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351 12/66 (18%)
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.