DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and Cda4

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster


Alignment Length:79 Identity:28/79 - (35%)
Similarity:34/79 - (43%) Gaps:7/79 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 KSSKYCPR--KNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKREGCNP 150
            |....||.  .||.:|  |||.|..||.|::|.....:|..||.||:....|.:.|.||   |.|
  Fly    23 KEEFQCPSHIANGNYA--DPATCRRFYQCVDGYPYLNRCPSGLFFDDVQKFCTFKDEAK---CGP 82

  Fly   151 EQRTSETGFVCPKD 164
            ...|.......|.|
  Fly    83 LPTTPAPATEAPAD 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726
CBM_14 95..143 CDD:366726 18/49 (37%)
CBM_14 180..225 CDD:366726
Cda4NP_728468.1 CBM_14 33..80 CDD:279884 20/51 (39%)
CE4_CDA_like_1 130..396 CDD:200596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.