DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and Peritrophin-A

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster


Alignment Length:232 Identity:68/232 - (29%)
Similarity:108/232 - (46%) Gaps:13/232 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LCAIAVTLCVAT--TVSAANFECPKPNG--QFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNR 65
            :|::.:...:|.  .::..:.|||:..|  .:|....||:|::|.:|....:.|.:||:||....
  Fly     6 VCSVLILAWIACGHALAVGSPECPEKYGVQAYAHTENCDQFFLCTNGTLTLETCENGLLFDGKGA 70

  Fly    66 KFNKCDQPFNVDCEDRTELQEPKSSKYCPRKNGFFAHPDPAVCNIFY-NCIEGDALETKCTVGLH 129
            ..|.|:..:.|||:.|.....|.|:..|..:.|.:|....  |:..| .|..|:..|..|..||.
  Fly    71 VHNHCNYNWAVDCKGRQWDPTPISTPACEYQFGLYAVSKD--CSTTYIKCAHGEPHEQDCDAGLA 133

  Fly   130 FDEYSGTCVWPDTAKREGCNPEQRTSETGFVCPKDQPKTDDRGQVVTHPKYPHPTDCQKFYVCLN 194
            :||....|.|||.. .|.||||   :..||.||..........:....|::|...||.:...|:.
  Fly   134 YDERIHGCNWPDQL-LEHCNPE---AVVGFKCPTKVDPNSVAARFWPFPRFPVAGDCHRLITCVE 194

  Fly   195 GEDPRDLGCQLGEVYNDATEMCDAPENVPG-CEDWYK 230
            |. ||.:.|...:|:::.|..|:.||...| |.::.|
  Fly   195 GH-PRLISCGEDKVFDEHTLTCEDPEYASGSCANYGK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 14/51 (27%)
CBM_14 95..143 CDD:366726 16/48 (33%)
CBM_14 180..225 CDD:366726 14/45 (31%)
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 14/46 (30%)
CBM_14 103..147 CDD:279884 16/45 (36%)
ChtBD2 179..218 CDD:214696 11/39 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1157817at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.