DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and AgaP_AGAP011416

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_554812.2 Gene:AgaP_AGAP011416 / 3291323 VectorBaseID:AGAP011416 Length:238 Species:Anopheles gambiae


Alignment Length:233 Identity:53/233 - (22%)
Similarity:78/233 - (33%) Gaps:61/233 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDCED-----RTELQEP 87
            |.........|.:||:|.:|......||:.:.||.   ..:.|.  :...|.|     ..:..||
Mosquito    27 PGTIMGSPTNCSEFYMCRNGRPVLFACPENMYFDV---DTSACG--YEAFCADNDVDFEQDPYEP 86

  Fly    88 KSSKYCPRKNGFFAHP---------------------DPAVCNIFYNCIEGDALETKCTVGLHFD 131
            ...:|.|.:    |:|                     |...|:.||.|.:...|..:|..|..||
Mosquito    87 PVPEYRPIE----ANPSQLVPTQTSVCRGAAPGAVRTDTTGCSAFYQCTKAGPLRLECPAGTLFD 147

  Fly   132 EYSGTCVWPDTAKREGCNPEQRTSETGFVCPKDQPKTDDRG-------QVVTHP-----KYPHPT 184
            .....|   |.|....|         .:..||  |.....|       :|:...     |:.|||
Mosquito   148 SNRLVC---DAADIVSC---------AYAPPK--PSIGGGGTGSGNLLEVLCFGKKNGYKFAHPT 198

  Fly   185 DCQKFYVCLNGEDPRDLGCQLGEVYNDATEMCDAPENV 222
            :|.::.||......::..|..|..||...::||...||
Mosquito   199 NCARYVVCNGRNKAQEFTCPTGTAYNKQRKICDFTHNV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 11/48 (23%)
CBM_14 95..143 CDD:366726 14/68 (21%)
CBM_14 180..225 CDD:366726 14/43 (33%)
AgaP_AGAP011416XP_554812.2 CBM_14 22..68 CDD:279884 11/45 (24%)
CBM_14 109..160 CDD:279884 13/53 (25%)
CBM_14 185..236 CDD:279884 13/50 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.