powered by:
Protein Alignment obst-A and CG34324
DIOPT Version :9
Sequence 1: | NP_001245778.1 |
Gene: | obst-A / 33022 |
FlyBaseID: | FBgn0031097 |
Length: | 237 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001096972.1 |
Gene: | CG34324 / 32302 |
FlyBaseID: | FBgn0085353 |
Length: | 267 |
Species: | Drosophila melanogaster |
Alignment Length: | 50 |
Identity: | 18/50 - (36%) |
Similarity: | 25/50 - (50%) |
Gaps: | 7/50 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 NGQF-ADEVQCDKFYVCDDGVAKAKLCPDGLVFD------PLNRKFNKCD 71
:|.| ||...|.::|||:...:|.:.||:|..|| .|....|.||
Fly 214 DGTFLADVRHCRRYYVCNRQRSKRQNCPNGYWFDRELKACRLASTVNNCD 263
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR23301 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.