DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG31077

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster


Alignment Length:321 Identity:69/321 - (21%)
Similarity:97/321 - (30%) Gaps:130/321 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CAIAV-TLCV-----------ATTVSAANF--------ECPKPNGQF-ADEVQCDKFYVCDDGVA 49
            |::.| .:|:           .||.|..||        :|  .:||. .|...|..|..|.||..
  Fly   686 CSVDVDEICLKSDKTIVLDLQTTTESTPNFTTSVDPFAKC--RDGQLRLDPKNCAGFLKCVDGEL 748

  Fly    50 KAKLCPDGLVFDPLNRKFNKCDQPFNVDCEDRTELQEPKSSKYCPRKNGFFAHPDPAVCNIFYNC 114
            |.::||.|..:   |...:||.......|        ..:.|||...   ....||..|..:..|
  Fly   749 KEEMCPSGFFY---NSTSSKCMVDIRATC--------VTNIKYCIEG---VREEDPNNCAGYRQC 799

  Fly   115 IEGDALETKCTVGLHFD--------------------------------------------EYSG 135
            |.|......|.:|.:|:                                            :.:|
  Fly   800 IRGLVQNLNCPLGQYFNVAERDCLMDVHKVCARTEEVYKSDEVQHNDTGPPMTKPDESCIRDING 864

  Fly   136 TCVWPDTAKREG--------------CNPEQRTSE---TGF-------VCPKDQPKTDDRGQVVT 176
            .||.|....|||              |...:...|   .||       :|     ..|.||..||
  Fly   865 VCVDPLAKCREGQHKLDPNNCAGYLKCQNGELIEELCPNGFYYDFLMKIC-----LVDRRGICVT 924

  Fly   177 H---------PKYPHPTDCQKFYVCLNGEDPRDLGCQLGEVYN--------DATEMCDAPE 220
            :         .:.||  ||..:..|::|: ..:|.|..|..:|        |..|:|..||
  Fly   925 NIQICDEGALEEDPH--DCAGYRQCIDGQ-VENLKCPFGTYFNVPLRDCLIDVDEICVRPE 982

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 15/50 (30%)
CBM_14 95..143 CDD:366726 13/91 (14%)
CBM_14 180..225 CDD:366726 15/49 (31%)
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696
CBM_14 267..308 CDD:279884
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884 13/38 (34%)
CBM_14 881..914 CDD:279884 4/32 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443996
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.