DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and Mur2B

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster


Alignment Length:199 Identity:52/199 - (26%)
Similarity:68/199 - (34%) Gaps:51/199 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ECPKPNGQFADEVQCDKFYVCDDGVAKAKL--CPDGLVFDPLNRKFNKCDQPFNVDCEDRTELQE 86
            :|.| .|:|.....|..:|.||....:..|  ||.|.:|.|:.||....||     |.. ||:.:
  Fly   148 QCQK-EGRFPHPHDCKVYYRCDKNRTQPWLFACPAGTIFSPVERKCLPGDQ-----CPS-TEISD 205

  Fly    87 PKSSKYCPR----------KNGFFAHPDPAVCNIFYNC---IEGDALET--KCTVGLHFDEYSGT 136
              |..|.|:          :.|.|.  .|..|.::|.|   ..|..|:|  ||.....||     
  Fly   206 --SGSYIPQNCELKFPECAEEGTFR--SPTDCALYYTCRLQESGTYLQTRFKCPGSNSFD----- 261

  Fly   137 CVWPDTAKREGCNPEQRTSETGFV-CPKDQPKTDDRGQVVTHPKYPHPTDCQKFYVCLNGEDPRD 200
                  .:|:.|.|........|| .|...|       ....|.||........|    .||..|
  Fly   262 ------LERKLCRPRSEVDCFDFVPGPVQVP-------YAPQPYYPPYPAAPPLY----EEDDYD 309

  Fly   201 LGCQ 204
            .|.:
  Fly   310 TGAR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 17/51 (33%)
CBM_14 95..143 CDD:366726 13/62 (21%)
CBM_14 180..225 CDD:366726 7/25 (28%)
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696
CBM_14 150..197 CDD:279884 15/47 (32%)
CBM_14 221..275 CDD:279884 16/66 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.