DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and Muc68E

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster


Alignment Length:204 Identity:51/204 - (25%)
Similarity:73/204 - (35%) Gaps:30/204 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TTVSAANFECPKPNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDCED 80
            ||.|.....|............|.|:..|.:|......||..|.:|  ..|| .|.....| |.:
  Fly  1617 TTSSLPPLSCSTGYQYLPHPTNCHKYIHCSNGHELIMECPANLYWD--YHKF-VCSGDSGV-CYN 1677

  Fly    81 RTELQEPKSSKYCPRKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKR 145
            .||...|: .|.|.....|.|||..  |.::..|..|.|||.||...|:::....:|.|    ..
  Fly  1678 DTENSNPE-EKVCGPGVDFLAHPTD--CTMYLQCSNGVALERKCPDPLYWNPEIKSCDW----SN 1735

  Fly   146 EGCNPEQRTSETGFVCPKDQPKTDDRGQVVTHPKYPHPTDCQKFYVC--LNGEDPRDLGCQLGEV 208
            :.|. ..|.|:: ..|.......            ...:||.|:..|  |.|.   .:.|..|..
  Fly  1736 KYCT-NLRASQS-ISCAAGMNFN------------VFQSDCSKYVKCFGLRGV---VMSCNSGLY 1783

  Fly   209 YNDATEMCD 217
            :|..:::|:
  Fly  1784 WNPVSQVCE 1792

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 11/49 (22%)
CBM_14 95..143 CDD:366726 15/47 (32%)
CBM_14 180..225 CDD:366726 10/40 (25%)
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696 9/32 (28%)
ChtBD2 1626..1668 CDD:214696 11/44 (25%)
ChtBD2 1688..1734 CDD:214696 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.