DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and C39D10.7

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_509334.3 Gene:C39D10.7 / 181050 WormBaseID:WBGene00016534 Length:1171 Species:Caenorhabditis elegans


Alignment Length:328 Identity:71/328 - (21%)
Similarity:103/328 - (31%) Gaps:124/328 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NFECP-KPNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDCEDR---- 81
            :|:|. ||||::..|.....|:.|.||.|.|..||..|||   |:....||  |..:||..    
 Worm   416 DFDCTGKPNGKYIKEACTKSFFTCHDGRAFANDCPGDLVF---NKATGTCD--FAENCEKNYMEP 475

  Fly    82 ----------------------TELQEPKSSKY------CPRKNGFFAHP--------------- 103
                                  |..::|.:..|      ..|.:..:..|               
 Worm   476 SQIYKGEDTPTTTIGYSSSVVYTTTEQPATKPYTQPPRDTERPSTIYGRPIYTKAPTTVGYEQPK 540

  Fly   104 ---------------DPAVC--------------NIFYNCIEGDALETKCTVGLHFDEYSGTCVW 139
                           |...|              ::||.|..|..:.|.|...|.|:.|.|.|.:
 Worm   541 ATYTTQAPVTTTIALDDFSCKHLADGNHASGLCKSVFYICANGQVVATTCPANLIFNPYVGECDY 605

  Fly   140 PDTAKREGCNPEQRTSETGFVCPK------DQPKTDDRGQVVTH--------------------- 177
            ....:  .|...|.|:...:..||      :||.|......:.:                     
 Worm   606 STNVR--DCQGYQPTTTPSYSYPKTTSKPYEQPSTTQGYAPIEYTPVTPGYAPQYTSTIFTTTLS 668

  Fly   178 PKYP----------HPTDCQKFYV-CLNGEDPRDLGCQLGEVYNDATEMCDAPENVPGCEDWYKD 231
            |||.          :..||:|:.: |.|.:..: ..|..|..|:...:.||..|||.||.: ||.
 Worm   669 PKYAAMCAKRDDGNYGFDCEKYLIKCYNRKTFK-FPCPSGLYYSRLQDKCDVKENVEGCPE-YKP 731

  Fly   232 VDD 234
            ..|
 Worm   732 TTD 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 20/49 (41%)
CBM_14 95..143 CDD:366726 15/91 (16%)
CBM_14 180..225 CDD:366726 14/55 (25%)
C39D10.7NP_509334.3 CBM_14 29..79 CDD:279884
CBM_14 98..148 CDD:279884
CBM_14 189..242 CDD:279884
ChtBD2 337..384 CDD:214696
CBM_14 419..467 CDD:279884 21/52 (40%)
CBM_14 560..612 CDD:279884 12/53 (23%)
CBM_14 675..726 CDD:279884 13/51 (25%)
CBM_14 774..825 CDD:279884
CBM_14 875..927 CDD:279884
CBM_14 941..992 CDD:279884
CBM_14 1010..1062 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.