DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and cht-1

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_508588.1 Gene:cht-1 / 180628 WormBaseID:WBGene00000503 Length:617 Species:Caenorhabditis elegans


Alignment Length:136 Identity:36/136 - (26%)
Similarity:56/136 - (41%) Gaps:18/136 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKREGCNPEQRTSETGF 159
            :.:||:  |:...|.:|..|:...:....|..||   :||.:..:..|:...||:  ..|:....
 Worm   484 KSDGFY--PNSNNCGLFVLCLSSKSYSMSCPSGL---QYSASLKYCTTSTASGCS--VTTTRAPT 541

  Fly   160 VCPKDQP--KTDDRGQVVTHPKYP--------HPTDCQKFYVCLNGEDPRDLGCQLGEVYNDATE 214
            ...|..|  .|..|....|.|.:.        .|:||.||..|:||.. .:..|..|..::..|.
 Worm   542 TTTKSAPTVTTTTRAPTTTTPAFKCTKDGFFGVPSDCLKFIRCVNGIS-YNFECPNGLSFHADTM 605

  Fly   215 MCDAPE 220
            |||.|:
 Worm   606 MCDRPD 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726
CBM_14 95..143 CDD:366726 11/47 (23%)
CBM_14 180..225 CDD:366726 15/49 (31%)
cht-1NP_508588.1 GH18_chitolectin_chitotriosidase 55..423 CDD:119351
Glyco_18 57..399 CDD:214753
CBM_14 481..532 CDD:279884 12/52 (23%)
CBM_14 567..615 CDD:279884 15/46 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.