DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and cbd-1

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_502145.2 Gene:cbd-1 / 178061 WormBaseID:WBGene00010351 Length:1319 Species:Caenorhabditis elegans


Alignment Length:262 Identity:63/262 - (24%)
Similarity:95/262 - (36%) Gaps:67/262 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AVTLCVATTVSAA---NFE--CPKPNGQ--FADEVQCDKFYVCDDGVAKAKLCPDGLVF--DPL- 63
            |:...:|||.:.|   .||  |...:|:  |:..|...|:..|..|.:|.:.|.:..||  |.| 
 Worm  1087 AIKDMIATTPAPAQPKQFEGRCAHVDGEAVFSIGVCSSKYLRCSYGASKLQQCSEDRVFSNDKLE 1151

  Fly    64 ---NRKFNKCDQPFNVDCEDRTELQEPKSSKY---------CP-RKNGFFAHPDPAVCNIFYNCI 115
               ....:.|..|.|           |...||         |. :::|.:.:...  |:....|.
 Worm  1152 CIVRESVSACTVPKN-----------PSIKKYYTSNDQSAFCDGKEDGLYRNERD--CSAILQCF 1203

  Fly   116 EGDALE-TKCTVGLHFDEYSGTCVWPDTAKREGCNPEQRTSETGFVCPKDQPKTDDRGQVVTHPK 179
            .|:..| ..|...|.|::.:|.|.:|.  |..||....:|:                |:...|..
 Worm  1204 GGELFEHPSCQSSLAFNQLTGKCDYPQ--KVSGCENHGQTN----------------GECSEHGS 1250

  Fly   180 Y-PHPTDCQKFYVCLNGEDPRDLGCQLGEVYNDATEMCDAPENVPGCEDWYKDV----------D 233
            : ....:|:.||.|:.|... .:.|..|.|:|....:||.|..||.|.....|.          |
 Worm  1251 FIADANNCEVFYRCVWGRKV-VMTCPSGTVFNPLLSVCDWPSAVPSCSGQASDSNSSYGSSTYND 1314

  Fly   234 DK 235
            ||
 Worm  1315 DK 1316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 15/57 (26%)
CBM_14 95..143 CDD:366726 11/48 (23%)
CBM_14 180..225 CDD:366726 14/45 (31%)
cbd-1NP_502145.2 ChtBD2 97..141 CDD:214696
ChtBD2 191..237 CDD:214696
CBM_14 692..743 CDD:307643
CBM_14 785..836 CDD:307643
CBM_14 1108..1161 CDD:307643 13/52 (25%)
CBM_14 1182..1235 CDD:307643 13/56 (23%)
CBM_14 1251..1296 CDD:307643 14/45 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.