Sequence 1: | NP_001245778.1 | Gene: | obst-A / 33022 | FlyBaseID: | FBgn0031097 | Length: | 237 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498551.3 | Gene: | cpg-2 / 175991 | WormBaseID: | WBGene00015102 | Length: | 524 | Species: | Caenorhabditis elegans |
Alignment Length: | 230 | Identity: | 56/230 - (24%) |
---|---|---|---|
Similarity: | 84/230 - (36%) | Gaps: | 57/230 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 PNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNV-DCEDRTELQEPKSSK 91
Fly 92 YCPRKNGFFAHPDPAVC-NIFYNCIEGDALETKCTVGLHFDEYSGTCVWPD-------------- 141
Fly 142 --TAKREGCNPEQRTSETGFVCPKDQPKTDDRGQVVTHPKYPHPTDCQKFYVCLNGEDPRDLGCQ 204
Fly 205 LGE----------VYNDATEMCDAPENVPGC--ED 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
obst-A | NP_001245778.1 | CBM_14 | 27..77 | CDD:366726 | 18/49 (37%) |
CBM_14 | 95..143 | CDD:366726 | 13/64 (20%) | ||
CBM_14 | 180..225 | CDD:366726 | 14/54 (26%) | ||
cpg-2 | NP_498551.3 | CBM_14 | 24..76 | CDD:279884 | |
CBM_14 | 138..190 | CDD:279884 | |||
ChtBD2 | 245..293 | CDD:214696 | 16/44 (36%) | ||
CBM_14 | 311..359 | CDD:279884 | 13/50 (26%) | ||
CBM_14 | 403..454 | CDD:279884 | 15/60 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160157822 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |