DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and cpg-2

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_498551.3 Gene:cpg-2 / 175991 WormBaseID:WBGene00015102 Length:524 Species:Caenorhabditis elegans


Alignment Length:230 Identity:56/230 - (24%)
Similarity:84/230 - (36%) Gaps:57/230 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNV-DCEDRTELQEPKSSK 91
            |||     |....|..|..|:|:...||..|||:|   ....||.|.:| :|   ..|..|:.: 
 Worm   256 PNG-----VCSTNFLTCSGGIARIMDCPASLVFNP---TILVCDWPRDVAEC---AGLPTPQPT- 308

  Fly    92 YCPRKNGFFAHPDPAVC-NIFYNCIEGDALETKCTVGLHFDEYSGTCVWPD-------------- 141
             | .::|:|:.   ..| :.|..|..|.|:...|..||.|.|.:..|.:..              
 Worm   309 -C-EEDGYFSF---GQCSSSFTACTNGRAIVMFCPAGLKFSESTVRCDYESNVSECQETSGEESG 368

  Fly   142 --TAKREGCNPEQRTSETGFVCPKDQPKTDDRGQVVTHPKYPHPTDCQKFYVCLNGEDPRDLGCQ 204
              :.::.|....:.:.|.......:....:::.|.|......|...|          .||.|.||
 Worm   369 EASGEQSGEGSGEASGEASGESSGEGSGVEEQNQCVGLDNGLHAIGC----------SPRVLSCQ 423

  Fly   205 LGE----------VYNDATEMCDAPENVPGC--ED 227
            .|.          |:||.:.:||.|:....|  ||
 Worm   424 NGHVDIFECPSSLVFNDQSLICDYPQTSLKCLIED 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 18/49 (37%)
CBM_14 95..143 CDD:366726 13/64 (20%)
CBM_14 180..225 CDD:366726 14/54 (26%)
cpg-2NP_498551.3 CBM_14 24..76 CDD:279884
CBM_14 138..190 CDD:279884
ChtBD2 245..293 CDD:214696 16/44 (36%)
CBM_14 311..359 CDD:279884 13/50 (26%)
CBM_14 403..454 CDD:279884 15/60 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157822
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.