DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and R02F2.4

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_498171.1 Gene:R02F2.4 / 175755 WormBaseID:WBGene00019833 Length:431 Species:Caenorhabditis elegans


Alignment Length:236 Identity:62/236 - (26%)
Similarity:96/236 - (40%) Gaps:72/236 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ECPKPNGQFAD------EVQCDK-FYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNV-DCED 80
            ||.:.:|::.:      :.:|.. |:.|.:|:|..:.||..|||:|   ..:.||.|.|| ||.:
 Worm   170 ECSQVSGEYCESDGNISKSECSNVFFSCSEGIAHRRNCPANLVFNP---AISSCDWPKNVMDCSE 231

  Fly    81 RTELQEPKSSKYCPRKNGFFAHPDPAVC-NIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAK 144
            ::|  :|::   |...:|:|:.   ..| :.|..|..|..:...|..||.|.|           |
 Worm   232 KSE--KPQN---CGEVDGYFSF---GRCSSSFSACTNGIPIVMFCPDGLMFSE-----------K 277

  Fly   145 REGCNPEQRTSE-----TGFV-----CPKDQPKTD-DRGQVVTHPKYPHPTDCQKFYVCLNGEDP 198
            .:.|:.|....|     :||:     .....|.|: |.|.        :..||          .|
 Worm   278 NQMCDYEWNVDECDLESSGFMENYKASEALTPCTNMDNGL--------YALDC----------TP 324

  Fly   199 RDLGCQLGE----------VYNDATEMCDAPENVPGC--ED 227
            |.|.||.|.          |:|:.:.:||.||....|  ||
 Worm   325 RVLSCQNGRENIFECPPSLVFNENSLICDYPETSLKCCMED 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 17/57 (30%)
CBM_14 95..143 CDD:366726 11/48 (23%)
CBM_14 180..225 CDD:366726 14/54 (26%)
R02F2.4NP_498171.1 CBM_14 25..74 CDD:279884
ChtBD2 117..165 CDD:214696
CBM_14 185..229 CDD:279884 16/46 (35%)
ChtBD2 240..283 CDD:214696 13/56 (23%)
CBM_14 310..361 CDD:279884 17/68 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157824
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.