DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and AgaP_AGAP001203

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_321953.1 Gene:AgaP_AGAP001203 / 1281965 VectorBaseID:AGAP001203 Length:168 Species:Anopheles gambiae


Alignment Length:90 Identity:25/90 - (27%)
Similarity:41/90 - (45%) Gaps:15/90 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VSAANFEC---PKPNGQFAD-EVQCDKFYVCDDG----VAKAKLCPDGLVFDPLNRKFNKCDQPF 74
            |...:|.|   |...|.:|: |..|..::.|.||    ...:.||.:|.:|   |:|...||..:
Mosquito    65 VPHTSFHCGNVPAIPGMYANVETGCQAYHTCHDGREGHQGASFLCTNGTLF---NQKEFACDWWY 126

  Fly    75 NVDCEDRTEL----QEPKSSKYCPR 95
            ||.||:....    .:|:.:.:.|:
Mosquito   127 NVKCEEAPSYYHLNADPEHNPFTPK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 16/54 (30%)
CBM_14 95..143 CDD:366726 0/1 (0%)
CBM_14 180..225 CDD:366726
AgaP_AGAP001203XP_321953.1 CBM_14 80..128 CDD:279884 15/50 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.