DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and AgaP_AGAP011616

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_320892.4 Gene:AgaP_AGAP011616 / 1281017 VectorBaseID:AGAP011616 Length:267 Species:Anopheles gambiae


Alignment Length:132 Identity:36/132 - (27%)
Similarity:56/132 - (42%) Gaps:31/132 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 SKYCPRKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKREGCNPEQRT 154
            |:.|..:|...:  :|:.||.:|.|:.|:.:...||||..|:..:..||..|....:...||..|
Mosquito    22 SESCVVENELTS--NPSTCNQYYRCLSGERILFSCTVGKVFNPSTKRCVTSDLYPCDETQPEITT 84

  Fly   155 SETGFVCPKDQPKTDDRGQVVTHPK--YPHPTDCQKFYVCLNGEDP------------RDLGCQL 205
            :|...:|             :.:|.  .|||:||.|:.:|..|...            :.|||  
Mosquito    85 AEPSLLC-------------LHNPNGIVPHPSDCDKYIICSGGLQTVQSCGYRENFSWKKLGC-- 134

  Fly   206 GE 207
            ||
Mosquito   135 GE 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726
CBM_14 95..143 CDD:366726 15/47 (32%)
CBM_14 180..225 CDD:366726 13/40 (33%)
AgaP_AGAP011616XP_320892.4 CBM_14 27..74 CDD:279884 15/48 (31%)
ChtBD2 91..134 CDD:214696 11/55 (20%)
ChtBD2 <221..257 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.