DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG43218

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001246864.1 Gene:CG43218 / 12798438 FlyBaseID:FBgn0262854 Length:182 Species:Drosophila melanogaster


Alignment Length:136 Identity:40/136 - (29%)
Similarity:58/136 - (42%) Gaps:15/136 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 PDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKREG-CN-----PEQRTSETGFVC 161
            ||...|:.:|.|.:|...:.||..||.||....|||.....:.:| |:     |...|:.|....
  Fly    44 PDCEDCSGYYICGDGSYEKVKCPQGLIFDIALNTCVLGQCPRFDGTCSANSTVPPPVTTTTTTAA 108

  Fly   162 PKDQPKT------DDRGQVVTHPKYPHPTDCQKFYVCLNGEDPRDLG-CQLGEVYNDATEMCDAP 219
            |:..|.|      :|....:.....||||.|:.||.|..  ....|| |:||:.::....:|:..
  Fly   109 PETIPPTPSGPCDNDVTCQLQEKSIPHPTHCRNFYTCYG--KCAVLGLCELGKWFDREGNVCNYS 171

  Fly   220 ENVPGC 225
            ..|..|
  Fly   172 HKVTNC 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726
CBM_14 95..143 CDD:366726 15/39 (38%)
CBM_14 180..225 CDD:366726 15/45 (33%)
CG43218NP_001246864.1 CBM_14 34..79 CDD:279884 13/34 (38%)
CBM_14 133..177 CDD:279884 15/45 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.