DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG43294

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001356903.1 Gene:CG43294 / 12798218 FlyBaseID:FBgn0262986 Length:143 Species:Drosophila melanogaster


Alignment Length:131 Identity:32/131 - (24%)
Similarity:48/131 - (36%) Gaps:42/131 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLCAIAVTLCVATTVSAANFECPKPNGQFADEVQCDKFYVCDDGVAKAKL--CPDGLVFDPLNR 65
            :.|||:....|:|.||.    ..|.||       .|.::|       :.:|  ||....:   |.
  Fly     9 VLLCAVFSGFCMAQTVQ----RWPFPN-------DCHRYY-------ETRLLDCPPEFYW---NS 52

  Fly    66 KFNKCDQPFNVDCE-------------DRTELQEPKSS---KYCPRK-NGFFAHPDPAVCNIFYN 113
            :..:|:....|.|.             :...::||::|   |.|..| |...  |.||.|..|..
  Fly    53 QLLQCNSQTPVGCSSIDPITNWNNSYPNSPPIKEPENSDLTKLCENKLNQLI--PYPADCTKFIR 115

  Fly   114 C 114
            |
  Fly   116 C 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 9/51 (18%)
CBM_14 95..143 CDD:366726 8/21 (38%)
CBM_14 180..225 CDD:366726
CG43294NP_001356903.1 CBM_14 96..139 CDD:307643 9/23 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.