DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and AgaP_AGAP006434

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_316470.3 Gene:AgaP_AGAP006434 / 1277042 VectorBaseID:AGAP006434 Length:519 Species:Anopheles gambiae


Alignment Length:244 Identity:71/244 - (29%)
Similarity:95/244 - (38%) Gaps:61/244 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CPKPNG----QFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDCED--RTE 83
            ||:.||    .|.:|..|.:||.||.|.|....||.||.|   |.:.:.||.|..|||..  |.|
Mosquito   284 CPRTNGYYPVMFRNEKDCSQFYQCDHGTAYLIQCPAGLHF---NTRLSVCDYPDKVDCNGPVRNE 345

  Fly    84 LQEPKSS----------------------KYCPRKNGFFAHPDPAV------CNIFYNCIEGDAL 120
            .....|:                      ..||.:||    |.|.:      |..:|.|..|.|.
Mosquito   346 HVTGGSNGVHGGSPSCAVCQSATTVVHRHPQCPTRNG----PHPIMFRHQTDCMKYYQCDHGTAF 406

  Fly   121 ETKCTVGLHFDEYSGTCVWPDTAKREGCNPEQRTSETGFVCPKDQPKTDDRGQVVTHPKYP---- 181
            |..|..||||:.....|.:|:   |.||:  :....:|.|  .:.|..|.......|||.|    
Mosquito   407 EITCPAGLHFNTALSVCDYPE---RVGCS--EGAEGSGGV--SEAPAVDRPVVAKIHPKCPAVTG 464

  Fly   182 --------HPTDCQKFYVCLNGEDPRDLGCQLGEVYNDATEMCDAPENV 222
                    ||.:|.|::.|..| ....|.|..|..::||.:.|...|::
Mosquito   465 RQEPAYWAHPHECGKYFGCQWG-CVELLSCPAGHRWDDAQKACSPDESL 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 20/53 (38%)
CBM_14 95..143 CDD:366726 17/53 (32%)
CBM_14 180..225 CDD:366726 14/55 (25%)
AgaP_AGAP006434XP_316470.3 CBM_14 50..88 CDD:279884
CBM_14 286..338 CDD:279884 21/54 (39%)
ChtBD2 <388..426 CDD:214696 12/37 (32%)
ChtBD2 457..506 CDD:214696 14/49 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.