DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and SCRASP1

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_315638.3 Gene:SCRASP1 / 1276311 VectorBaseID:AGAP005625 Length:1322 Species:Anopheles gambiae


Alignment Length:213 Identity:51/213 - (23%)
Similarity:69/213 - (32%) Gaps:69/213 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ECPK-PNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDC---EDRTEL 84
            |||: ..|.|...:.|.:|..|..|......|..|.:|:|..|   :||.|..|.|   .....:
Mosquito   181 ECPEGRTGHFPYVMDCRQFLSCWKGRGFILNCAPGTLFNPNTR---ECDHPSKVSCLPVPSLNSV 242

  Fly    85 QEPKSSKYCPRKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKREGCN 149
            .||  :...|.|...:....|                                  |...:::...
Mosquito   243 NEP--ANRAPPKLASYTDQRP----------------------------------PQQFQQQQRQ 271

  Fly   150 PEQRTSETGFVCPKDQPKTDDRGQ-VVTHPK-----YPHPTDCQKFYVCLNG----EDPRDLGCQ 204
            |:..           ||:...|.| .:|.|.     .||||||:||..|.||    :|     |.
Mosquito   272 PQYL-----------QPQQSQRQQEELTCPPGVIGLRPHPTDCRKFLNCNNGARFVQD-----CG 320

  Fly   205 LGEVYNDATEMCDAPENV 222
            .|..:|.....||...||
Mosquito   321 PGTAFNPLILTCDHLRNV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 14/50 (28%)
CBM_14 95..143 CDD:366726 3/47 (6%)
CBM_14 180..225 CDD:366726 19/47 (40%)
SCRASP1XP_315638.3 ChtBD2 181..228 CDD:214696 16/49 (33%)
ChtBD2 289..334 CDD:214696 17/49 (35%)
LDLa 731..762 CDD:238060
SRCR 776..878 CDD:278931
SR 776..877 CDD:214555
LDLa 884..921 CDD:238060
SR 927..1025 CDD:214555
SRCR 932..1025 CDD:278931
Tryp_SPc 1078..1309 CDD:214473
Tryp_SPc 1079..1312 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.