DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and AgaP_AGAP010469

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_311475.4 Gene:AgaP_AGAP010469 / 1272568 VectorBaseID:AGAP010469 Length:967 Species:Anopheles gambiae


Alignment Length:273 Identity:68/273 - (24%)
Similarity:90/273 - (32%) Gaps:92/273 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SAANFEC---------PKPNGQFADEVQ----------CDKFYVCDDGVAKAKLCPDGLVFDPLN 64
            |:.:.:|         |.......|:|:          |:::|||.:|.|...|||||...|.  
Mosquito   255 SSTSLQCDDSNVPGSTPGTTPGICDDVEDGVMIIHPQFCNQYYVCVEGNAYPTLCPDGQWLDV-- 317

  Fly    65 RKFNKCDQPFNVDCEDRTELQEPKSSKYCPRKNGFFAHPDPAV---------------CNIFYNC 114
             :...|.:|.:|               |||  ||....|.|:|               |..:|.|
Mosquito   318 -EKQACGKPIDV---------------YCP--NGPPTTPTPSVCVDVADGVYVPSPERCEAYYVC 364

  Fly   115 IEGDALETKCTVGLHFDEYSGTCVWPDTAKREGCN-PEQRTSETGFVCPKDQPKT---DDRGQVV 175
            .........|..||.||:.:..|:.|..|.   || |...|.......|...|.:   ::..|:.
Mosquito   365 AGEIGYILYCPPGLWFDQTTRECISPSDAI---CNIPTPPTPPPTPTIPPTIPPSGPPEEGNQLC 426

  Fly   176 THPK----YPHPTDCQKFYVCLNGED-----------------PRDLGCQLGEVY---------- 209
            ....    .|.|.||..||:|.||..                 .|...|..|..|          
Mosquito   427 NESPNGTYLPSPADCSSFYICFNGGAYPSNCLDFILIPSNTLCERYYSCYQGIAYPNKCPSGLWF 491

  Fly   210 NDATEMCDAPENV 222
            |..|.|||.||||
Mosquito   492 NPNTNMCDDPENV 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 16/59 (27%)
CBM_14 95..143 CDD:366726 15/62 (24%)
CBM_14 180..225 CDD:366726 22/70 (31%)
AgaP_AGAP010469XP_311475.4 ChtBD2 99..147 CDD:214696
CBM_14 278..329 CDD:279884 17/68 (25%)
CBM_14 343..393 CDD:279884 10/49 (20%)
CBM_14 462..504 CDD:279884 11/41 (27%)
CBM_14 552..603 CDD:279884
CBM_14 650..701 CDD:279884
CBM_14 766..819 CDD:279884
CBM_14 911..958 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.