DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and AgaP_AGAP000359

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_310753.4 Gene:AgaP_AGAP000359 / 1271898 VectorBaseID:AGAP000359 Length:492 Species:Anopheles gambiae


Alignment Length:240 Identity:55/240 - (22%)
Similarity:79/240 - (32%) Gaps:89/240 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FECP--KPNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDCEDRTELQ 85
            |:||  :.||.|||.|.|.:||.|.||......||.||.||.:                      
Mosquito    25 FKCPVEQGNGNFADPVTCRRFYQCVDGFPYLNRCPSGLYFDDI---------------------- 67

  Fly    86 EPKSSKYCPRKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWP-DTAKREGCN 149
                .|||..|                       .|.||  |......:.|...| |.||:  ||
Mosquito    68 ----QKYCTFK-----------------------AEAKC--GPLAATPAATTESPIDLAKK--CN 101

  Fly   150 PEQ------RTSETGFVCPKD-QPKTDDRGQVVTHPKYPHPTDCQKFYVCLNGEDPRDLGC---- 203
            |.:      ..::.|.:.||. .|:...:..::|.....:..:.:.:....||:.....||    
Mosquito   102 PAECELPYCYCNKDGTLIPKGLDPEETPQIILLTFDGAVNLNNYEHYRKVFNGKRKNPNGCDIKG 166

  Fly   204 ------------QLGEVYNDATEMCDAPENV--------PGCEDW 228
                        |:..:.||..|:  |.|.:        .|.|:|
Mosquito   167 TFFISHEYSNYQQIQTLANDGHEI--AVETISLQMGLQDKGYEEW 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 18/49 (37%)
CBM_14 95..143 CDD:366726 8/48 (17%)
CBM_14 180..225 CDD:366726 10/68 (15%)
AgaP_AGAP000359XP_310753.4 ChtBD2 25..74 CDD:214696 24/74 (32%)
CE4_CDA_like_1 129..395 CDD:200596 14/83 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.