DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and AgaP_AGAP003751

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_310283.7 Gene:AgaP_AGAP003751 / 1271483 VectorBaseID:AGAP003751 Length:721 Species:Anopheles gambiae


Alignment Length:222 Identity:41/222 - (18%)
Similarity:72/222 - (32%) Gaps:64/222 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NFECP-KPNGQFAD-EVQCDKFYVCDDGVAK--AKLCPDGLVFDPLNRKFNKCDQPFNVDC---- 78
            :|.|. :..|.:|| |..|..:::| ||:.:  :..||:..:|   .::...||..:.|:|    
Mosquito    46 SFSCTGRAAGYYADVETGCQIYHMC-DGLGRQFSYACPNTTLF---QQRMLICDHWYMVNCSKAE 106

  Fly    79 ------------------EDRTELQEPKSSKY---------CPRKNGFFAHPDPAVCNIFYNCIE 116
                              |:..|::.|:....         .|....||....||..|..::...
Mosquito   107 SNYAANLLIGQRDKPFVPEEENEIRTPRPDLLDRPDALDFGAPSLKNFFKSSTPARQNAIFDTQS 171

  Fly   117 GDALETKCTVGLHFDEYSGTC-----VWPDTAKREG-------------CNPEQRTSETGFVCP- 162
            .....:...||....|...|.     ::.::|...|             ..|...|.......| 
Mosquito   172 RSRSSSSSIVGKGQSEKRTTTSPNAEIFQESASNHGLPIHWSGRFADENATPTNETQPAAREQPG 236

  Fly   163 -----KDQPKTDDRGQVVTHPKYPHPT 184
                 :|:.|.:.| :.:|......||
Mosquito   237 QTKTKRDEDKNESR-KTITITTSERPT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 13/52 (25%)
CBM_14 95..143 CDD:366726 9/52 (17%)
CBM_14 180..225 CDD:366726 2/5 (40%)
AgaP_AGAP003751XP_310283.7 CBM_14 49..102 CDD:279884 15/56 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.