DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and AgaP_AGAP006793

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_308954.3 Gene:AgaP_AGAP006793 / 1270272 VectorBaseID:AGAP006793 Length:208 Species:Anopheles gambiae


Alignment Length:137 Identity:34/137 - (24%)
Similarity:56/137 - (40%) Gaps:20/137 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 NGFFAHPDPAV-----------CNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKREGCNP 150
            :||.|...|.:           |..:..|....|:|.:|..|..:|....||: |.|::.:....
Mosquito    14 SGFTADVSPCLGDKPYAPHATDCTRYLVCSGTKAIELRCPPGSEWDADETTCL-PFTSESKCAVL 77

  Fly   151 EQRTSETGFVCPKDQPKTDDRGQVVTHPK-----YPHPTDCQKFYVCLNGEDPRDLGCQLGEVYN 210
            :....:...:..|..|:. .|..|..:|.     .|| :||:|||.|::.. |.:|.|.....:|
Mosquito    78 QSLALDAPPIVNKCPPQL-SRCPVYANPAKEVIFMPH-SDCKKFYACVSAV-PVELSCPTRLYWN 139

  Fly   211 DATEMCD 217
            ..:..||
Mosquito   140 HESCQCD 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726
CBM_14 95..143 CDD:366726 14/56 (25%)
CBM_14 180..225 CDD:366726 14/38 (37%)
AgaP_AGAP006793XP_308954.3 ChtBD2 29..67 CDD:214696 9/38 (24%)
CBM_14 110..155 CDD:279884 14/39 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.