DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB10 and ANNAT4

DIOPT Version :9

Sequence 1:NP_001162804.1 Gene:AnxB10 / 33019 FlyBaseID:FBgn0000084 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_181409.1 Gene:ANNAT4 / 818457 AraportID:AT2G38750 Length:319 Species:Arabidopsis thaliana


Alignment Length:332 Identity:87/332 - (26%)
Similarity:154/332 - (46%) Gaps:37/332 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AAPFDASQDAQVLRAAMKGFGTDEQEIIDVLVGRSNQQ-----RQTIKAVY----EAEFER---D 64
            |.|.:.....:.:.|.| |.|.||..:|..| |:|.::     |:..|:.:    |..||:   .
plant     2 ALPLELESLTEAISAGM-GMGVDENALISTL-GKSQKEHRKLFRKASKSFFVEDEERAFEKCHDH 64

  Fly    65 LVDDLKDELGGKFEDVIVGLMMPPVEYLCKQLHAAMAGIGTEEA--TLVEILCTKTNEEMAQIVA 127
            .|..||.|. .:|...:|...|.|.|...:.:..|:.  ..|||  .:||:.||::.|::.....
plant    65 FVRHLKLEF-SRFNTAVVMWAMHPWERDARLVKKALK--KGEEAYNLIVEVSCTRSAEDLLGARK 126

  Fly   128 VYEERYQRPLAEQMCSETSGFFRRLLTLIVTGVR-DGLDTPVDVGQ--AKEQAAQLYSAGEAKLG 189
            .|...:.:.:.|.:.|...|..|:||..:|:..| :|.....|..:  ||..|..:.|:||..:.
plant   127 AYHSLFDQSMEEDIASHVHGPQRKLLVGLVSAYRYEGNKVKDDSAKSDAKILAEAVASSGEEAVE 191

  Fly   190 TDEEVFNRIMSHASFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAIVECVQSPAAFFAN 254
            .||.|  ||::..|...|:.:::.:..:.|..:...:  ..|..|:||::    |:..||.:|:.
plant   192 KDEVV--RILTTRSKLHLQHLYKHFNEIKGSDLLGGV--SKSSLLNEALI----CLLKPALYFSK 248

  Fly   255 RLYKAMNGAGTDDAT---LIRIIVSRSE--IDLETIKQEFERIYNRTLHSAVVDAETSGDYKRAL 314
            .|..::| ...|..|   |.|:.|:|::  .::..||:|:..:|..||...:.: :..|:|:..|
plant   249 ILDASLN-KDADKTTKKWLTRVFVTRADHSDEMNEIKEEYNNLYGETLAQRIQE-KIKGNYRDFL 311

  Fly   315 TALLGSA 321
            ..||..:
plant   312 LTLLSKS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB10NP_001162804.1 Annexin 19..84 CDD:278615 21/76 (28%)
Annexin 91..156 CDD:278615 16/66 (24%)
Annexin 176..241 CDD:278615 16/64 (25%)
Annexin 251..317 CDD:278615 18/70 (26%)
ANNAT4NP_181409.1 Annexin 90..155 CDD:413385 16/66 (24%)
Annexin 245..314 CDD:413385 18/70 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0819
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D856254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.