DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB10 and anxa6

DIOPT Version :9

Sequence 1:NP_001162804.1 Gene:AnxB10 / 33019 FlyBaseID:FBgn0000084 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_002937305.2 Gene:anxa6 / 779574 XenbaseID:XB-GENE-989741 Length:671 Species:Xenopus tropicalis


Alignment Length:312 Identity:139/312 - (44%)
Similarity:210/312 - (67%) Gaps:2/312 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TVKDAAPFDASQDAQVLRAAMKGFGTDEQEIIDVLVGRSNQQRQTIKAVYEAEFERDLVDDLKDE 72
            ::||...|||:|||::|..||||||:|::.|:|::..|||.||..|...|::.:.:||:||||.|
 Frog     9 SIKDYPDFDANQDAEILYKAMKGFGSDKEAILDLIASRSNHQRIQITQAYKSLYGKDLIDDLKYE 73

  Fly    73 LGGKFEDVIVGLMMPPVEYLCKQLHAAMAGIGTEEATLVEILCTKTNEEMAQIVAVYEERYQRPL 137
            |.||||.:|||||.||..:..|::..|:||.||:|..|:|||.::.|:|:..:.|.|::.|.|.|
 Frog    74 LTGKFERLIVGLMRPPPYFDAKEIKDALAGAGTDEKCLIEILASRNNQEVHALAAAYKDAYDRDL 138

  Fly   138 AEQMCSETSGFFRRLLTLIVTGVRDGLDTPVDVGQAKEQAAQLYSAGEAKLGTDEEVFNRIMSHA 202
            ...:..:|||.|:::|.:::.|.|:. |..|.....::.|..|:.|||.|.||||..|..|:...
 Frog   139 ETDVIKDTSGHFKKMLIVLLQGTREE-DDVVSEDLVEQDAQDLFEAGEQKWGTDEAQFIFILGSR 202

  Fly   203 SFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAIVECVQSPAAFFANRLYKAMNGAGTDD 267
            |...|.|||::|:.:||:|||::||.|:|.:..:.|:|:|:|::|...:||.||||:|.|.||.|
 Frog   203 SKQHLHLVFDKYQEISGKTIEESIKAELSGDFQDLMLAVVKCIRSTREYFATRLYKSMKGMGTAD 267

  Fly   268 ATLIRIIVSRSEIDLETIKQEFERIYNRTLHSAVVDAETSGDYKRALTALLG 319
            .|||||:|||||||:..|::.|...|.::|.| ::..:|||:||:.|..|.|
 Frog   268 NTLIRIMVSRSEIDMLNIRESFRTKYQKSLFS-MIKNDTSGEYKKTLLKLCG 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB10NP_001162804.1 Annexin 19..84 CDD:278615 34/64 (53%)
Annexin 91..156 CDD:278615 23/64 (36%)
Annexin 176..241 CDD:278615 28/64 (44%)
Annexin 251..317 CDD:278615 34/65 (52%)
anxa6XP_002937305.2 Annexin 20..85 CDD:365936 34/64 (53%)
Annexin 92..157 CDD:365936 23/64 (36%)
Annexin 175..241 CDD:365936 28/65 (43%)
Annexin 251..316 CDD:365936 34/65 (52%)
Annexin 366..430 CDD:365936
Annexin 437..502 CDD:365936
Annexin 525..591 CDD:365936
Annexin 601..666 CDD:365936
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8092
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H55558
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D500720at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10502
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X76
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.