DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB10 and PRNP

DIOPT Version :9

Sequence 1:NP_001162804.1 Gene:AnxB10 / 33019 FlyBaseID:FBgn0000084 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_000302.1 Gene:PRNP / 5621 HGNCID:9449 Length:253 Species:Homo sapiens


Alignment Length:99 Identity:17/99 - (17%)
Similarity:30/99 - (30%) Gaps:31/99 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 YEER-------------YQRPLAEQMCSETSGFFRRLLTLIVTGVRDGLDTPVDVGQAKEQAAQL 180
            ||:|             |.||:.|.  |..:.|....:.:.:                |:.....
Human   145 YEDRYYRENMHRYPNQVYYRPMDEY--SNQNNFVHDCVNITI----------------KQHTVTT 191

  Fly   181 YSAGEAKLGTDEEVFNRIMSHASFPQLRLVFEEY 214
            .:.||....||.::..|::......|.....:.|
Human   192 TTKGENFTETDVKMMERVVEQMCITQYERESQAY 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB10NP_001162804.1 Annexin 19..84 CDD:278615
Annexin 91..156 CDD:278615 9/39 (23%)
Annexin 176..241 CDD:278615 7/39 (18%)
Annexin 251..317 CDD:278615
PRNPNP_000302.1 Prion_bPrPp 1..28 CDD:288443
PRP 23..240 CDD:197548 17/99 (17%)
Interaction with GRB2, ERI3 and SYN1. /evidence=ECO:0000250|UniProtKB:P04925 23..230 17/99 (17%)
Interaction with ADGRG6. /evidence=ECO:0000250|UniProtKB:P04925 23..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..108
5 X 8 AA tandem repeats of P-H-G-G-G-W-G-Q 51..91
51..59
60..67
68..75
76..83
84..91
Prion 134..251 CDD:278789 17/99 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10502
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.