DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB10 and anxa13

DIOPT Version :9

Sequence 1:NP_001162804.1 Gene:AnxB10 / 33019 FlyBaseID:FBgn0000084 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001015787.1 Gene:anxa13 / 548504 XenbaseID:XB-GENE-979599 Length:316 Species:Xenopus tropicalis


Alignment Length:313 Identity:132/313 - (42%)
Similarity:203/313 - (64%) Gaps:4/313 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PTVKDAAPFDASQDAQVLRAAMKGFGTDEQEIIDVLVGRSNQQRQTIKAVYEAEFERDLVDDLKD 71
            ||:|....|||.:||:.:..|.||.||||:.||::|..|::.|||.:|..|:..:.:||...||.
 Frog     6 PTIKLHHDFDAERDAKKIYKACKGLGTDEKAIIEILANRTSDQRQELKQKYKTLYGKDLESVLKS 70

  Fly    72 ELGGKFEDVIVGLMMPPVEYLCKQLHAAMAGIGTEEATLVEILCTKTNEEMAQIVAVYEERYQRP 136
            ||.|.||...:.|:..|.|:..::|.:||.|.||.|:.|::||||::|:::......|:..:.|.
 Frog    71 ELSGNFEKTALALLDRPCEFDARELRSAMKGAGTNESLLIQILCTRSNQQIKATKEAYKRLFDRD 135

  Fly   137 LAEQMCSETSGFFRRLLTLIVTGVRD-GLDTPVDVGQAKEQAAQLYSAGEAKLGTDEEVFNRIMS 200
            |...:.|||||:||::|..::...|| ||....|:  |.:.|.:||.||||:.||:|..||.|::
 Frog   136 LESDIKSETSGYFRKILISLLQANRDEGLSINEDL--AGQDAKRLYEAGEARWGTEESEFNIILA 198

  Fly   201 HASFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAIVECVQSPAAFFANRLYKAMNGAGT 265
            ..::.|||..|:.|::|.|:.|...||.|.|.:|.:|...||:..:....:||.:|||||.||||
 Frog   199 TRNYMQLRATFKAYEILHGKDILDVIKSETSGDLKKAYSTIVQVTRDCQGYFAKKLYKAMKGAGT 263

  Fly   266 DDATLIRIIVSRSEIDLETIKQEFERIYNRTLHSAVVDAETSGDYKRALTALL 318
            ::|.||||:|:|:||||:|||:.::::|.::|..| :.::||||:.|.|.|||
 Frog   264 NEAMLIRILVTRAEIDLQTIKERYQQLYKKSLGEA-IKSDTSGDFCRLLLALL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB10NP_001162804.1 Annexin 19..84 CDD:278615 27/64 (42%)
Annexin 91..156 CDD:278615 24/64 (38%)
Annexin 176..241 CDD:278615 27/64 (42%)
Annexin 251..317 CDD:278615 34/65 (52%)
anxa13NP_001015787.1 Annexin 18..83 CDD:365936 27/64 (42%)
Annexin 90..155 CDD:365936 24/64 (38%)
Annexin 173..235 CDD:365936 26/61 (43%)
Annexin 249..314 CDD:365936 34/65 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9762
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54302
OrthoDB 1 1.010 - - D500720at33208
OrthoFinder 1 1.000 - - FOG0000105
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X76
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.