DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB10 and anxa3a

DIOPT Version :9

Sequence 1:NP_001162804.1 Gene:AnxB10 / 33019 FlyBaseID:FBgn0000084 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001004632.2 Gene:anxa3a / 447893 ZFINID:ZDB-GENE-040912-58 Length:340 Species:Danio rerio


Alignment Length:313 Identity:128/313 - (40%)
Similarity:195/313 - (62%) Gaps:4/313 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TVKDAAPFDASQDAQVLRAAMKGFGTDEQEIIDVLVGRSNQQRQTIKAVYEAEFERDLVDDLKDE 72
            |:|..|.|:.|:|...||.|::|.||:|:.:|::|..||:.|:|.|...|....:|.|.:|||.|
Zfish    28 TIKAKANFNVSEDVAALRKAIEGVGTNEKTLIEILTHRSSSQKQEIAKAYRETTKRILANDLKGE 92

  Fly    73 LGGKFEDVIVGLMMPPVEYLCKQLHAAMAGIGTEEATLVEILCTKTNEEMAQIVAVYEERYQRPL 137
            ..|.||.|:|||..|......:.||.|:.|.||:...|:|||.::||:::.::.|.|.|..::.|
Zfish    93 THGNFEKVLVGLARPLAVNDAEWLHEALKGAGTDNNILIEILSSRTNKQIKELSAAYAEETKKTL 157

  Fly   138 AEQMCSETSGFFRRLLTLIVTGVRDGLDTP-VDVGQAKEQAAQLYSAGEAKLGTDEEVFNRIMSH 201
            .:.:.:|.||.:.:.:.|:..|.||  :.| |:|.:|:|.|..||.|||.||||||..|..|:..
Zfish   158 TQALKTEVSGHYGKAIILLAEGARD--ENPSVNVDKAREDAQALYQAGEKKLGTDESKFIEILCK 220

  Fly   202 ASFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAIVECVQSPAAFFANRLYKAMNGAGTD 266
            .||||||....|||..|..|::::|:.|||..|.|.:::||:|..|..|:||.:|.|:|.|||||
Zfish   221 RSFPQLRQTILEYKNFSKNTLQKSIEKEMSGNLEELLVSIVKCAISTPAYFAEKLNKSMKGAGTD 285

  Fly   267 DATLIRIIVSRSEIDLETIKQEFERIYNRTLHSAVVDAETSGDYKRALTALLG 319
            :.||.|::|||.|:|:..|:.|::.:|..:|:.| :.::.||||...|..:.|
Zfish   286 ETTLTRVMVSRGEVDMLDIRAEYKTLYKSSLYKA-ISSDVSGDYADCLKMICG 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB10NP_001162804.1 Annexin 19..84 CDD:278615 27/64 (42%)
Annexin 91..156 CDD:278615 19/64 (30%)
Annexin 176..241 CDD:278615 31/64 (48%)
Annexin 251..317 CDD:278615 28/65 (43%)
anxa3aNP_001004632.2 Annexin 40..104 CDD:306660 27/63 (43%)
Annexin 112..176 CDD:306660 19/63 (30%)
Annexin 195..260 CDD:306660 31/64 (48%)
Annexin 270..335 CDD:306660 28/65 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0819
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54302
OrthoDB 1 1.010 - - D500720at33208
OrthoFinder 1 1.000 - - FOG0000105
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X76
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.