DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB10 and anxa7

DIOPT Version :9

Sequence 1:NP_001162804.1 Gene:AnxB10 / 33019 FlyBaseID:FBgn0000084 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_012821793.2 Gene:anxa7 / 407959 XenbaseID:XB-GENE-987772 Length:536 Species:Xenopus tropicalis


Alignment Length:312 Identity:151/312 - (48%)
Similarity:210/312 - (67%) Gaps:2/312 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TVKDAAPFDASQDAQVLRAAMKGFGTDEQEIIDVLVGRSNQQRQTIKAVYEAEFERDLVDDLKDE 72
            |:|.|..|||..||:.||.||||||||||.|:||:..|||.|||.|||.::..:.:||:.|||.|
 Frog   226 TIKAAPNFDALSDAEKLRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTAYGKDLIKDLKSE 290

  Fly    73 LGGKFEDVIVGLMMPPVEYLCKQLHAAMAGIGTEEATLVEILCTKTNEEMAQIVAVYEERYQRPL 137
            |.|..|::|:.|.||...|....|:.||.|.||:|..|:|||||:||.|:..||:.|:..:.|.:
 Frog   291 LSGNVEELIIALFMPATYYDAWSLYHAMKGAGTQERVLIEILCTRTNSEIKNIVSCYKHEFGRDI 355

  Fly   138 AEQMCSETSGFFRRLLTLIVTGVRDGLDTPVDVGQAKEQAAQLYSAGEAKLGTDEEVFNRIMSHA 202
            .:.:.|:|||.|.|||..:..|.||. :..|::.||::.|.:||.|||.||||||..||.:::..
 Frog   356 EKDIRSDTSGHFERLLISMCQGNRDE-NQNVNLQQAEQDAQRLYQAGEGKLGTDESSFNLVLASR 419

  Fly   203 SFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAIVECVQSPAAFFANRLYKAMNGAGTDD 267
            ||||||.|.|.|..:|.:.:...|..|.|..:.:.:.|:::|..:..||||.|||::|.||||||
 Frog   420 SFPQLRAVAEAYARISKRDLISVIGREFSGYIEDGLKAVLQCAINRPAFFAERLYRSMKGAGTDD 484

  Fly   268 ATLIRIIVSRSEIDLETIKQEFERIYNRTLHSAVVDAETSGDYKRALTALLG 319
            :|||||||:||||||..|||.:.:::.::| ||.:.::|||||:|.|.|:.|
 Frog   485 STLIRIIVTRSEIDLVQIKQAYVQMHQKSL-SAAISSDTSGDYRRLLIAIAG 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB10NP_001162804.1 Annexin 19..84 CDD:278615 36/64 (56%)
Annexin 91..156 CDD:278615 29/64 (45%)
Annexin 176..241 CDD:278615 27/64 (42%)
Annexin 251..317 CDD:278615 39/65 (60%)
anxa7XP_012821793.2 PTZ00009 <158..195 CDD:240227
Annexin 238..302 CDD:395139 36/63 (57%)
Annexin 309..374 CDD:395139 29/64 (45%)
Annexin 392..458 CDD:395139 27/65 (42%)
Annexin 468..533 CDD:395139 39/65 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9762
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54302
OrthoDB 1 1.010 - - D500720at33208
OrthoFinder 1 1.000 - - FOG0000105
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X76
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.