DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB10 and anxa1.1

DIOPT Version :9

Sequence 1:NP_001162804.1 Gene:AnxB10 / 33019 FlyBaseID:FBgn0000084 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_989364.1 Gene:anxa1.1 / 394995 XenbaseID:XB-GENE-977623 Length:343 Species:Xenopus tropicalis


Alignment Length:313 Identity:122/313 - (38%)
Similarity:191/313 - (61%) Gaps:1/313 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PTVKDAAPFDASQDAQVLRAAMKGFGTDEQEIIDVLVGRSNQQRQTIKAVYEAEFERDLVDDLKD 71
            |::|....|:|:.||..|..|:|..|.||..|||:|..|:|.:||.|:|.|:....:.|.|.||.
 Frog    29 PSLKANPGFNAAADAANLDKAIKAKGVDEGTIIDILTKRTNCERQQIRAAYQQLTGKSLDDALKK 93

  Fly    72 ELGGKFEDVIVGLMMPPVEYLCKQLHAAMAGIGTEEATLVEILCTKTNEEMAQIVAVYEERYQRP 136
            .|....|:|::||:..|.::...:|..|:.|:||:|..|:|||.::||.|:.:|..||:|.:::.
 Frog    94 CLKSHLEEVVLGLLKTPAQFDAHELRGAIKGLGTDEDCLIEILVSRTNCEIKEINKVYKEEFKKE 158

  Fly   137 LAEQMCSETSGFFRRLLTLIVTGVRDGLDTPVDVGQAKEQAAQLYSAGEAKLGTDEEVFNRIMSH 201
            |.:.:..:|||.|::.|..:..|.|:. ||.|:..||...|..||.|||.:.|||...|..|:::
 Frog   159 LGKDILGDTSGDFQKTLLALSKGERNE-DTRVNEDQADNDARALYEAGEKRKGTDVSTFINILTN 222

  Fly   202 ASFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAIVECVQSPAAFFANRLYKAMNGAGTD 266
            .|:|.::.|.:.|...|...:.:||..||..:|.:.:|:||:|..|..|:||.|.|.||.|:||.
 Frog   223 KSYPHIQKVLQRYARYSKNDLNRAIDLEMKGDLEKCLMSIVKCASSKPAYFAERFYLAMKGSGTR 287

  Fly   267 DATLIRIIVSRSEIDLETIKQEFERIYNRTLHSAVVDAETSGDYKRALTALLG 319
            ...|||::||||||||:.||..::|:|.::|..|:::.:..|||:..:.||.|
 Frog   288 HNALIRVLVSRSEIDLKEIKTCYKRLYGKSLRQAIMEEKLKGDYETIMLALCG 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB10NP_001162804.1 Annexin 19..84 CDD:278615 26/64 (41%)
Annexin 91..156 CDD:278615 23/64 (36%)
Annexin 176..241 CDD:278615 22/64 (34%)
Annexin 251..317 CDD:278615 29/65 (45%)
anxa1.1NP_989364.1 Annexin 50..106 CDD:365936 22/55 (40%)
Annexin 113..178 CDD:365936 23/64 (36%)
Annexin 197..262 CDD:365936 22/64 (34%)
Annexin 272..338 CDD:365936 29/65 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D500720at33208
OrthoFinder 1 1.000 - - FOG0000105
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10502
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X76
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.