DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB10 and anxa11b

DIOPT Version :9

Sequence 1:NP_001162804.1 Gene:AnxB10 / 33019 FlyBaseID:FBgn0000084 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_861431.1 Gene:anxa11b / 353365 ZFINID:ZDB-GENE-030707-5 Length:485 Species:Danio rerio


Alignment Length:325 Identity:145/325 - (44%)
Similarity:218/325 - (67%) Gaps:10/325 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PVP--------TVKDAAPFDASQDAQVLRAAMKGFGTDEQEIIDVLVGRSNQQRQTIKAVYEAEF 61
            |.|        |:||....|..:|.:|||.|||||||||..||::|..|||:||..:.|.|:..:
Zfish   162 PAPAINRGFRGTIKDFPGADPLRDVEVLRKAMKGFGTDENAIIELLGSRSNKQRVPLLAAYKTTY 226

  Fly    62 ERDLVDDLKDELGGKFEDVIVGLMMPPVEYLCKQLHAAMAGIGTEEATLVEILCTKTNEEMAQIV 126
            .:|||.|||.||.|.||::::.::..|.::...:...|::|.||:||.|:|||.:::|.|:.:|.
Zfish   227 GKDLVRDLKSELTGHFEELVLAMLKSPAQFDASECKEAISGAGTDEACLIEILSSRSNAEIKEIN 291

  Fly   127 AVYEERYQRPLAEQMCSETSGFFRRLLTLIVTGVRDGLDTPVDVGQAKEQAAQLYSAGEAKLGTD 191
            .:|:..|.:.|.:.:.::|||.|||||..:..|.||..:| ||:..||:.|.:|:||||.|:|||
Zfish   292 RIYKAEYGKSLEDAISNDTSGHFRRLLVSLCQGNRDERET-VDISMAKQDAQKLHSAGENKVGTD 355

  Fly   192 EEVFNRIMSHASFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAIVECVQSPAAFFANRL 256
            |..||.|:...|.|.||.||:||:.:.|:.||::|..|||.:|...|:|:|:|:::..|:||.||
Zfish   356 ESQFNAILCARSKPHLRQVFQEYQQMCGRDIEKSICREMSGDLESGMVAVVKCIKNTPAYFAERL 420

  Fly   257 YKAMNGAGTDDATLIRIIVSRSEIDLETIKQEFERIYNRTLHSAVVDAETSGDYKRALTALLGSA 321
            :|||.||||.|.|||||:|||||:|:..|:||:.|::.::|::. :..:||||||:.|..|.|.:
Zfish   421 HKAMQGAGTKDRTLIRIMVSRSELDMLDIRQEYLRLFGKSLYTH-ISGDTSGDYKKLLLKLCGGS 484

  Fly   322  321
            Zfish   485  484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB10NP_001162804.1 Annexin 19..84 CDD:278615 34/64 (53%)
Annexin 91..156 CDD:278615 24/64 (38%)
Annexin 176..241 CDD:278615 31/64 (48%)
Annexin 251..317 CDD:278615 35/65 (54%)
anxa11bNP_861431.1 WWbp <1..70 CDD:304964
DUF1720 7..90 CDD:285440
Annexin 184..249 CDD:278615 34/64 (53%)
Annexin 256..321 CDD:278615 24/64 (38%)
Annexin 339..405 CDD:278615 31/65 (48%)
Annexin 415..480 CDD:278615 35/65 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0819
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54302
OrthoDB 1 1.010 - - D500720at33208
OrthoFinder 1 1.000 - - FOG0000105
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X76
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.